KEGG   Citrus clementina (mandarin orange): CICLE_v10020176mgHelp
Entry
CICLE_v10020176mg CDS       T02982                                 

Definition
(RefSeq) hypothetical protein
  KO
K04688  ribosomal protein S6 kinase beta [EC:2.7.11.1]
Organism
cic  Citrus clementina (mandarin orange)
Brite
KEGG Orthology (KO) [BR:cic00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:cic01001]
    CICLE_v10020176mg
Enzymes [BR:cic01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     CICLE_v10020176mg
Protein kinases [BR:cic01001]
 Serine/threonine kinases: AGC group
  RSK family [OT]
   CICLE_v10020176mg
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like Pkinase_fungal Pkinase_C RIO1 Kdo Haspin_kinase APH FTA2
Motif
Other DBs
NCBI-GeneID: 18049478
NCBI-ProteinID: XP_006439715
UniProt: V4TMP8
LinkDB All DBs
Position
Unknown
AA seq 441 aa AA seqDB search
MVSTSQKNLHSLLTTKLKKLTITPPSASSPDFDFTEVFGPLTPCRHNNQSPASTSASLGD
PQVIHNRSHSFVGPSPRYALSSSLPLQIQELEHENDAELEAESERKIGPGDFEIFRVVGQ
GAFGKVFQVKKKGVDDGDSDGIYAMKVMRKDTIIKKNHVDYMKAERDILTKVTHPFIVQL
RYSFQTRSKLYLILDFINGGHLFFHLYRQGIFREDQARFYTAEIVSAVSHLHKCGIVHRD
LKPENILMDSDGHVMLTDFGLAKEIDESSRSNSMCGTTEYMAPEILLSKGHNKDADWWSV
GILLYEMLTGQPPFTHANRQKLQQRIINEKVKLPPFLTSEAHSLLKGLLHKDPSKRLGSG
PGGVDAIKHHKWFRSINWKTLEAREMQPKFKPDVSGKDCIANFDKCWTTMPADDSPAPTP
TAGEHFKGYTYVAPNPWLSSV
NT seq 1326 nt NT seq  +upstreamnt  +downstreamnt
atggtgtccacgtcacagaaaaaccttcactcactattaacaacgaaactgaaaaagcta
accatcaccccaccctccgcttcttccccagacttcgacttcaccgaagtcttcggaccc
ttaacgccctgccgccacaacaaccaatcacctgcatccacgtcagcctctttgggtgac
ccgcaggtgatccacaaccgttcccactctttcgtgggtccctcccctcgttacgccctc
tcctcctcccttcctctccaaatccaagaactcgaacacgaaaacgatgccgaattggaa
gctgaaagtgagagaaagatcgggccgggtgattttgagatatttagggttgtgggacag
ggcgcgtttggtaaagtgtttcaagtgaagaagaaaggagtcgatgatggcgatagtgat
gggatttatgcaatgaaagttatgagaaaagatacgattataaagaagaatcatgtggat
tacatgaaagctgaaagggatatcctcaccaaagtcacccatccttttattgtccagctc
cgctactctttccagacgaggtctaagctgtatttgatattggactttataaatggaggg
catctcttctttcatctgtatcggcaaggaatcttccgtgaggatcaggcaaggttttat
actgctgagatagtatctgcggtttcacatcttcacaagtgcgggatcgtgcaccgggat
cttaaaccagaaaatatactcatggattctgatgggcatgttatgctaactgatttcgga
cttgcaaaggaaattgacgaatcaagtagatcaaattcaatgtgtggaaccacagaatac
atggctcctgaaattttactttcaaaaggccacaacaaggatgcagattggtggagtgtt
ggaattctcctgtatgaaatgttgacggggcagccaccgtttacacatgcaaatagacag
aagcttcaacagagaattattaatgagaaagtgaaacttccaccttttcttaccagtgaa
gctcactctttgcttaaaggattgctgcacaaggacccatctaaaaggttaggtagcggg
cctggtggagtggacgccatcaaacaccacaaatggtttcgatcaatcaactggaagacg
ttggaggccagagaaatgcagccaaaattcaagccagatgtgagtggaaaagactgtata
gccaatttcgacaagtgctggacaacaatgccggcagatgattcaccggctcccacaccg
acagcaggtgagcatttcaaagggtacacttatgtggcgcctaacccttggctttcatca
gtatga

DBGET integrated database retrieval system