KEGG   Citrus clementina (mandarin orange): CICLE_v10024071mgHelp
Entry
CICLE_v10024071mg CDS       T02982                                 

Definition
(RefSeq) hypothetical protein
  KO
K11423  histone-lysine N-methyltransferase SETD2 [EC:2.1.1.43]
Organism
cic  Citrus clementina (mandarin orange)
Pathway
cic00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:cic00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    CICLE_v10024071mg
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:cic03036]
    CICLE_v10024071mg
Enzymes [BR:cic01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     CICLE_v10024071mg
Chromosome and associated proteins [BR:cic03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     CICLE_v10024071mg
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SET
Motif
Other DBs
NCBI-GeneID: 18050200
NCBI-ProteinID: XP_006441970
UniProt: V4TU14
LinkDB All DBs
Position
Unknown
AA seq 427 aa AA seqDB search
MANAALQEEIHDDNEIDDEGSPMFASPSANSQDTTRSPFHQANTGMSHNMYRNSEDHDYI
AEPLPSMGLSMDDELMTLNLMNSDNSRIGHAFNKLLKQIGNPVEFELPDWFIKPKAIPYV
FIKRNIYLTKRIKRRLEDDGIFCSCTASPGSSGVCDRDCHCGMLLSSCSSGCKCGNSCLN
KPFQNRPVKKMKLVQTEKCGAGIVADEDIKRGEFVIEYVGEVIDDKTCEERLWKMKHLGE
TNFYLCEINRDMVIDATYKGNKSRYINHSCCPNTEMQKWIIDGETRIGIFATRDIKKGEN
LTYDYQYEFLHDSLIAYLFNDYMLCVLIMDTCDFANLAIQAFFIGMYVFYQNGDLHIGSS
RPPYNQRQICPQCCIGKVIRISHPKNESSFGIIRRFDEYSRKHSVLFEDGESEFIDMAKV
DWELVTD
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
atggctaatgcagcacttcaagaagaaatccatgatgataatgagattgatgatgaaggt
tctcccatgtttgcttccccttctgcaaattctcaagacactactcgatcaccatttcac
caagccaacaccggcatgtctcataatatgtatagaaatagtgaagatcatgattacatt
gctgaaccgcttccttcgatgggactctctatggatgatgagcttatgaccttaaattta
atgaattctgataatagccggataggccatgcgtttaataagttgttgaaacagattggg
aacccagttgagtttgaattacccgattggtttattaaaccgaaggccataccttatgtc
ttcattaagcgaaatatatatcttacaaagaggattaagagacggcttgaggatgatggc
atattctgctcttgcacagcatcaccaggttcttctggtgtttgtgacagagactgtcat
tgtgggatgctcctgtctagctgctcttctggctgtaaatgtgggaattcatgccttaat
aagccattccagaaccgacctgtgaagaagatgaaattagtgcagacagagaaatgtgga
gctgggattgtggcagatgaagatattaaacgaggagagtttgtaattgaatatgttggg
gaagttattgatgacaaaacatgtgaagaaagactttggaaaatgaagcaccttggagaa
actaacttttacctgtgtgagatcaatcgtgacatggtaattgatgccacatacaaagga
aataaatcaagatacataaaccatagttgctgccccaatactgagatgcagaaatggata
attgatggtgaaacgagaataggcatatttgcaactcgtgacataaaaaagggcgaaaat
ctgacctacgactaccagtacgaattcttgcatgactctcttattgcatacttgttcaat
gattatatgttgtgtgttttgattatggatacctgcgattttgctaacttagctatccaa
gcttttttcattggtatgtatgttttttatcagaatggagatttgcatataggcagttcg
cgacctccttataatcaacgacaaatatgccctcaatgttgcattggcaaagtgattaga
atatcccatcccaagaatgagagttcttttgggattattagacggtttgatgagtattcc
agaaaacactcggtcttgtttgaagatggtgagagtgagtttattgacatggctaaagta
gattgggaacttgtaactgactga

DBGET integrated database retrieval system