KEGG   Citrus clementina (mandarin orange): CICLE_v10024826mgHelp
Entry
CICLE_v10024826mg CDS       T02982                                 

Definition
(RefSeq) hypothetical protein
  KO
K11430  histone-lysine N-methyltransferase EZH2 [EC:2.1.1.43]
Organism
cic  Citrus clementina (mandarin orange)
Pathway
cic00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:cic00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    CICLE_v10024826mg
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:cic03036]
    CICLE_v10024826mg
Enzymes [BR:cic01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     CICLE_v10024826mg
Chromosome and associated proteins [BR:cic03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     CICLE_v10024826mg
   Polycomb group proteins
    PRC2-EZH2 complex
     CICLE_v10024826mg
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SET preSET_CXC TCR
Motif
Other DBs
NCBI-GeneID: 18036917
NCBI-ProteinID: XP_006425927
UniProt: V4SF38
LinkDB All DBs
Position
Unknown
AA seq 925 aa AA seqDB search
MASKASPSASPNRSEPLKSSSLTKTENGTLTRKEILSVIDCLKNQVAADHFVSVQRRVEK
NRQKLIGVTNHLYRLSLERRNNQTINTHGSVDLLTKRQREALGVQNGIDVSSGDRDSHIS
QEDGYASTAVYGSSNPTKNIIRPIKLNDNKRLPPYTTWIFLDRNQRMTEDQSVMSRRRIY
YDQNGGEALICSDSEEEVIEEEEKKDFVDSEDYILRMTIKEVGLSDATLESLAQCFSRSP
SEVKARYEILSKEESAVGGSNNGNDEHTMNNFLVKDLEAALDSFDNLFCRRCLVFDCRLH
GCSQDLVFPAEKQPLWYHLDEGNVPCGPHCYRSVLKSERNATACSPLNGDIKEKFISSSD
GAGAQTSSRKKFSGPARRVKSHQSESASSNAKNLSESSDSEVGQRQDTAFTHHSSPSKSK
LVGKVGICKRKSKRVAERALVCKQKKQKKTAAFDLDSVASGGVLPSDMKLRSTSRKENED
ANSSSHKHAKSSSSGKTRKKEMQIQDSRNLMHVRVPLGSSQEIISNPPAISTNDSLRKDE
FVAENMCKQELSDEKSWKTIEKGLFDKGVEIFGRNSCLIARNLLNGLKTCWEVFQYMTCS
ENKLFCQAGDAATSLLEGYSKFDFNGTTGNNEVRRRSRYLRRRGRVRRLKYTWKSAAYHS
IRKRITERKDQPCRQYNPCGCQTACGKQCPCLLNGTCCEKYCGCPKSCKNRFRGCHCAKS
QCRSRQCPCFAADRECDPDVCRNCWISCGDGSLGVPDQKGDNYECRNMKLLLKQQQRVLL
GRSDVSGWGAFLKNSVGKHEYLGEYTGELISHREADKRGKIYDRENSSFLFNLNDQFVLD
AYRKGDKLKFANHSPDPNCYAKVIMVAGDHRVGIFAKERISAGEELFYDYRYEPDRAPAW
ARKPEASGSKKEEGGPSSGRAKKLA
NT seq 2778 nt NT seq  +upstreamnt  +downstreamnt
atggcctcgaaggcatcgccttctgcctctcctaacagatcggagcctctcaaaagctct
tcgttgacaaaaacagaaaatggaactctgactcgtaaggagattttatctgttattgat
tgtttaaagaatcaggttgctgctgaccattttgtttccgttcagagaagggtggaaaaa
aataggcaaaagttgattggtgttacaaatcatctgtatagactatcattggagagaaga
aacaaccaaacaataaatacacatggtagtgtagatttactaacaaagaggcaaagagaa
gcgcttggtgtgcaaaacggtattgatgtaagtagtggggatagagatagtcacatatct
caggaagatggttatgcttctaccgcagtttatggatctagtaaccctaccaagaatatt
attcgtcctattaagctcaatgacaataaaagattacctccttataccacatggatattt
ttagacagaaatcaaagaatgactgaggatcaatcggtgatgagtcgaaggagaatttat
tatgaccaaaatggtggtgaagcactaatctgcagtgacagcgaggaggaagtaattgag
gaagaggaaaagaaagattttgtggattctgaagattatattctgcgcatgactattaaa
gaagttggtttatctgatgccacgctggaatcactggcccaatgtttctccagaagccct
tctgaagtcaaggcaagatatgaaattttgtcgaaggaagagagtgctgtagggggctct
aacaatgggaatgatgagcacactatgaataactttcttgtaaaagaccttgaagcagct
ctggattcttttgacaacctgttttgtcgccgatgtcttgtctttgattgcaggttacat
ggatgttcacaggatcttgtctttccggctgagaaacaacctctgtggtaccatctagac
gagggaaatgtaccatgtggaccacattgttatcgatcggttctcaagtcagaaagaaat
gctacagcgtgctcacccttgaatggtgatatcaaagaaaaattcatctcttcatctgat
ggtgctggggctcagacatcatctaggaagaaattttctggtcctgctagaagggtgaag
tcccaccaaagtgaaagtgcttcttcaaatgcaaaaaacctttcagaaagcagtgattca
gaggttgggcagaggcaggacaccgcttttactcaccactcatcaccctcaaagagtaag
cttgtagggaaagttggaatctgcaagaggaagagcaagcgagttgctgagcgcgctcta
gtttgcaagcaaaagaaacagaagaaaacggcagcttttgatttggattctgttgcgagt
ggaggtgttttgcccagcgacatgaaacttaggtcaacttctcgcaaagaaaatgaagat
gctaattcctcttcacataagcatgcaaaatcttcatcctctgggaagaccaggaagaag
gaaatgcaaattcaggacagccgcaatttgatgcatgtcagagttccccttggctcgtca
caggagatcatttctaatccacctgcaatcagcactaatgactccttgagaaaagacgag
tttgtggctgaaaacatgtgtaaacaagaactaagtgatgagaaatcttggaaaactatt
gaaaaaggcctctttgataaaggtgttgaaatttttggcaggaacagctgtctgatagcc
agaaacctattaaatggtttgaagacttgttgggaggttttccagtatatgacttgctct
gagaataaactattttgccaagcaggtgatgctgcaacttctcttcttgaaggctattca
aagtttgattttaatggaactacgggtaacaatgaagtgagaagaagatcaagatattta
cgtaggaggggtagagttcgtcgcttgaagtatacttggaagtctgctgcttaccattca
attaggaaacggatcactgagagaaaagatcagccatgccggcagtacaatccttgtggc
tgccaaactgcttgtggaaagcaatgtccttgccttctaaatggaacctgctgtgaaaag
tactgtggatgtcccaagagctgcaaaaatcggttcagaggctgtcattgcgctaaaagt
caatgtcgcagtcgtcagtgtccatgttttgctgctgaccgggaatgtgatccagatgtt
tgtaggaactgttggatcagttgtggtgatggtagtcttggggttcctgaccaaaaaggt
gataactatgaatgtaggaatatgaagcttctgctcaaacaacaacaaagggttttactt
ggaagatccgatgtttctgggtggggagctttcttaaagaatagtgttggaaagcatgaa
taccttggtgaatacactggcgagctgatttctcatcgggaggctgacaagcgtgggaaa
atatatgatcgtgaaaattcatcatttctcttcaatctgaatgatcagtttgttcttgat
gcttatcggaagggtgataaactgaaatttgccaatcattctcctgatccaaactgctat
gcaaaggtcatcatggttgcgggagaccaccgtgttggcatctttgccaaggagcgaatt
agtgccggagaggaactgttttatgactatcgttatgagccagacagagctcctgcttgg
gctaggaagcctgaagcatctggttcaaaaaaggaggaaggtggtccttcaagtggtcgt
gccaagaagcttgcttag

DBGET integrated database retrieval system