KEGG   Citrus clementina (mandarin orange): CICLE_v10025149mgHelp
Entry
CICLE_v10025149mg CDS       T02982                                 

Definition
(RefSeq) hypothetical protein
  KO
K00234  succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1]
Organism
cic  Citrus clementina (mandarin orange)
Pathway
cic00020  Citrate cycle (TCA cycle)
cic00190  Oxidative phosphorylation
cic01100  Metabolic pathways
cic01110  Biosynthesis of secondary metabolites
cic01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:cic00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    CICLE_v10025149mg
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    CICLE_v10025149mg
Enzymes [BR:cic01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     CICLE_v10025149mg
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 Thi4 GIDA FAD_binding_3 DAO HI0933_like
Motif
Other DBs
NCBI-GeneID: 18037058
NCBI-ProteinID: XP_006425687
UniProt: V4SED1
LinkDB All DBs
Position
Unknown
AA seq 632 aa AA seqDB search
MWRCVSRGLGLSSYRSKRSVSNDSLRSHFSRLFSTNSTGGYTIVDHTYDAVVVGAGGAGL
RAAIGLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMTEDDWRWHMYDTVKGSDWLG
DQDAIQYMCREAPKAVIELENYGLPFSRTEDGKIYQRAFGGQSLDFGKGGQAYRCACAAD
RTGHALLHTLYGQAMKHNTQFFVEYFALDLIMNSDGTCQGVIALNMEDGTLHRFRAASTI
LATGGYGRAYFSATSAHTCTGDGNAMVSRAGLPLEDLEFVQFHPTGIYGAGCLITEGSRG
EGGILRNSEGERFMERYAPTAKDLASRDVVSRSMTMEIREGRGVGPLKDHIYLHLNHLPP
DVLKERLPGISETAAIFAGVDVTKEPIPVLPTVHYNMGGIPTNHHGEVVTIKGDDPDEVV
PGLMAAGEAACASVHGANRLGANSLLDIVVFGRACANRVAEIQRPGEKQKPLENNAGERT
VAWLDKIRNSNGSIPTSKIRLNMQRVMQNNAAVFRTQETLEEGCQLIDKAWESFHDVKLT
DRSLIWNTDLIETIELENLLINACITMHSAEARKESRGAHAREDFTKRDDENWMKHTLGY
WENEKVRLDYRPVHMNTLDDEIESFPPKARVY
NT seq 1899 nt NT seq  +upstreamnt  +downstreamnt
atgtggcgctgcgtttctcgtggccttggcttatcttcttatcgttcaaaacgatcagtc
tccaatgactctctcagatctcatttctccagattgttctccaccaattccactggagga
tacacaatagtggatcatacatatgacgctgtagtggttggagctggcggtgctgggctg
agagcagcgattgggctttcagagcatggcttcaacaccgcttgcattaccaagctcttc
cctactcgttctcacactgttgcggctcagggtggtattaatgctgctttaggaaacatg
actgaagatgactggaggtggcacatgtatgacacagtcaagggaagtgattggttaggt
gatcaggatgctattcaatatatgtgtagggaggcaccaaaagcagtgattgagctggag
aattacgggttaccattttctcggacagaagatggaaaaatataccagcgtgcatttggc
ggtcaaagtcttgattttggaaaaggtgggcaggcgtaccgttgtgcatgtgctgctgac
agaactggtcatgctctattgcataccctctatggccaggctatgaaacataatacacag
ttctttgtggaatattttgctttggatctaattatgaacagtgatggtacctgccaagga
gtaattgctttgaatatggaggacggaacattgcatcgtttccgtgctgcttcaaccatt
ctggccacagggggctatggtagggcctacttttctgcaacctctgctcatacatgcaca
ggagatggcaatgcaatggtttcgcgtgctgggctcccacttgaggatttggaatttgta
caatttcacccaactggtatatatggggctgggtgccttattactgaaggatctcgcggt
gaaggtggtatccttagaaatagtgaaggtgaacgatttatggaacgttatgcccctaca
gccaaggatcttgcatcaagagatgttgtttcaagatccatgaccatggaaattcgggaa
ggtcgtggtgtaggacctctgaaggaccatatctatctacacttgaaccacttgcctcca
gatgtactcaaggagaggcttcctggtatatctgaaactgctgctattttcgctggtgtt
gatgtcacgaaggagcctattcctgtcttaccaactgtgcactataatatgggtggaatt
ccaactaatcaccatggagaggtagttactatcaaaggtgatgatccggatgaagtagtt
cctggacttatggctgctggggaggctgcctgtgcatcagttcatggtgccaaccggctg
ggtgcaaattctcttcttgacattgttgttttcggtcgagcttgtgcaaatagagttgca
gaaatccagaggccaggggagaaacaaaagcctttagaaaacaatgctggtgagaggacc
gttgcctggctggacaaaataagaaattcaaatggttcaataccaacttcaaaaattcgg
ttgaatatgcaacgcgtgatgcaaaataatgccgctgtcttccgaacacaggaaacattg
gaggaaggttgtcaattaattgacaaggcatgggagagtttccatgatgttaagttgaca
gatcgtagtttgatatggaacactgacttgatagaaactatagagttggaaaaccttttg
ataaatgcatgcatcaccatgcattctgctgaagccaggaaagagagtagaggagctcat
gcacgtgaagattttacgaaaagagatgatgagaactggatgaagcacactctgggatat
tgggagaatgagaaggtacgattggattacagaccagttcacatgaatacgctggacgat
gaaattgagtccttcccacctaaagctcgtgtatattga

DBGET integrated database retrieval system