KEGG   Citrus clementina (mandarin orange): CICLE_v10028040mgHelp
Entry
CICLE_v10028040mg CDS       T02982                                 

Definition
(RefSeq) hypothetical protein
  KO
K01110  phosphatidylinositol-3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN [EC:3.1.3.16 3.1.3.48 3.1.3.67]
Organism
cic  Citrus clementina (mandarin orange)
Pathway
cic00562  Inositol phosphate metabolism
cic01100  Metabolic pathways
cic04070  Phosphatidylinositol signaling system
Brite
KEGG Orthology (KO) [BR:cic00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    CICLE_v10028040mg
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    CICLE_v10028040mg
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:cic01009]
    CICLE_v10028040mg
Enzymes [BR:cic01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     CICLE_v10028040mg
    3.1.3.48  protein-tyrosine-phosphatase
     CICLE_v10028040mg
    3.1.3.67  phosphatidylinositol-3,4,5-trisphosphate 3-phosphatase
     CICLE_v10028040mg
Protein phosphatases and associated proteins [BR:cic01009]
 Protein tyrosine phosphatases (PTPs)
  Class I PTPs (Dual specificity phosphatases)
   Phosphatase and Tensin homologs (PTEN)
    CICLE_v10028040mg
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DSPc Y_phosphatase Y_phosphatase3 CDKN3
Motif
Other DBs
NCBI-GeneID: 18035456
NCBI-ProteinID: XP_006422958
UniProt: V4UAC8
LinkDB All DBs
Position
Unknown
AA seq 611 aa AA seqDB search
MDSGSADSSASPLTKASEVKPSPTTESATDNSASDARSKISATGISSWAKSLKIPQPFSG
SQEDSPTGNSGKSTFARLTSGLGLRSSPKSPQSDDSSEGTSTAAQPGFIGSITKGLVDSS
KSAVKAVQVKARHVVSQNKRRYQDGGFDLDMTYITENIIAMGFPAGDMSSGFFGYVEGFY
RNHMEEVIKFFETYHKDKYKVYNLCSERLYDASLFEGKVASFPFDDHNCPPIQLITSFCH
SAYSWLKEDIENVVVVHCKAGMARTGLMISSLLLYLKFFPTAEESIDYYNQKRCVDGKGL
VLPSQIRYVKYFERILTYFNGENQPGRRCMLRGFRLHRCPYWIRPHITVSDHNGVLFSSK
KHPRTKDLSPEDFWFSAPKKGVMVFALPGEPGLAELAGDFKIHFHDRQGDFYCWLNTTMM
ENRKVLNTGDLDGFDKRKLPSPGFQVEVVLADYNGPVRAAANSETVAKKPDETSGSAPAS
VGQGLDASKESKDSGNNDKDDVFSDNESEEAGSKSKKAPAASAAGGTVSAAPRSETKTES
DQVANLACATKDVSLGNAVSQPTHAAGETKGGAVAGPTSGLDTSNRESEFKAMAADASVF
SFGDEDDYESD
NT seq 1836 nt NT seq  +upstreamnt  +downstreamnt
atggattctggatctgctgattcatcagcttcgcctcttacgaaggcttctgaagtaaaa
ccttctcctactacagaatctgcaacagataattctgcaagtgatgcacgatcaaagatt
tctgctactgggatatcatcatgggccaaaagtttgaaaattcctcagccattttctggc
tcacaagaggattcaccaactggaaattctggaaaatcaacttttgcacgtcttactagt
ggcttaggactgcgctcatctccaaaatctcctcagtcagatgatagttctgaggggact
tcaacagctgcacaacctggttttattggatcaattaccaagggcttggttgactcgtct
aagagtgcagtgaaggctgtacaggtcaaggctcgccatgttgtctctcaaaataaacga
agataccaggatggaggatttgatttggatatgacatatatcactgagaatataattgca
atgggattccctgctggtgacatgagctcagggtttttcggatatgttgagggattctac
cgaaaccacatggaagaagtgattaaattctttgaaacctatcacaaggacaagtacaaa
gtgtacaatctttgttcagagaggctttatgatgcatcgttatttgaggggaaggtggct
agtttcccttttgatgatcacaactgccccccaattcaactaataacatcattttgtcat
agtgcatattcgtggttgaaggaagatattgagaatgttgttgttgtgcactgtaaggct
ggaatggcaaggacagggttaatgatttctagccttctactgtacttgaagttcttcccc
actgctgaggaatctattgactactacaaccagaaaagatgtgtggatgggaaaggcctt
gtcctgccaagtcaaattaggtatgtcaaatactttgaaaggatcttaacatacttcaat
ggagagaatcagcccgggcgtcggtgcatgctaaggggtttccggcttcataggtgtcct
tactggattaggccccacataacagtctctgatcataatggtgtactcttctcctcaaag
aagcatcctagaaccaaggatttgtcgccagaagacttttggtttagtgcgcctaagaaa
ggagttatggtctttgccctgcctggagagccaggtttggcagagttggctggggacttc
aaaatccattttcatgaccgtcaaggagatttctactgctggttaaacacaaccatgatg
gagaacagaaaagttctaaacactggcgatcttgatggatttgataagaggaaactgcct
tcaccaggattccaggtggaagttgtattggcagattataatggccctgttcgagctgca
gccaactctgaaactgttgccaagaagccagatgaaacgtcaggttctgctccagcctca
gttggccagggtctagatgcttcaaaagaaagtaaggactcgggaaataacgataaagat
gatgtgttctcagacaatgagtccgaagaagctggatcaaaaagcaagaaagctccagca
gcctctgcggctggaggaactgtctctgccgctcccagatcagaaacaaagaccgagtcg
gatcaagttgcaaatttagcgtgtgcgaccaaagatgtttctttgggaaacgcagtctcc
caacctacacatgctgctggtgagacaaaggggggtgctgttgcgggacctacctccggc
ctcgacactagcaacagggaaagtgaattcaaggcaatggctgctgatgcatctgtgttc
tcgttcggagatgaagacgactacgaaagtgactga

DBGET integrated database retrieval system