KEGG   Citrus clementina (mandarin orange): CICLE_v10029196mgHelp
Entry
CICLE_v10029196mg CDS       T02982                                 

Definition
(RefSeq) hypothetical protein
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
cic  Citrus clementina (mandarin orange)
Pathway
cic04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:cic00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    CICLE_v10029196mg
Enzymes [BR:cic01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     CICLE_v10029196mg
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sod_Cu
Motif
Other DBs
NCBI-GeneID: 18034880
NCBI-ProteinID: XP_006424441
UniProt: V4SKX6
LinkDB All DBs
Position
Unknown
AA seq 234 aa AA seqDB search
MQAAIAAMAHVLLVAAPPSSSHTLLATLPNPSSVTRSSSSSSHSPSLHSAFHGVSLKFPS
RLNLSLAAVASKKPLTVVAAAKKAVAVLKGTSNVEGVVTLTQEDGGPTTVNVRVTGLTPG
PHGFHLHEYGDTTNGCISTGAHFNPNNMTHGAPKDEVRHAGDLGNIVANANGSVAEATIV
DNQISLDGPNTVVGRAFVVHELEDDLGKGGHELSLTTGNAGGRLACGVVGLTPV
NT seq 705 nt NT seq  +upstreamnt  +downstreamnt
atgcaagccgcaatagcagccatggctcacgttctcctcgtagcagcaccgccctcttca
tctcacacactccttgccacattgccaaatcctagcagtgtcacgcgctcttcctcttct
tcttctcattctccctcgcttcactctgcattccacggcgtctccctcaaattcccctct
cgtctcaacttatctctcgccgccgtggcctccaagaagccgttgactgtcgttgctgcc
gccaagaaagcggtggctgttcttaaaggcacttccaatgttgaaggagttgttacgttg
acccaagaagatggcggtcctacgactgtcaatgttcgtgtcactggtcttactcctggg
cctcacgggttccacctacacgaatatggtgatacgacaaatgggtgtatatcaacagga
gcacatttcaatcctaataacatgacacacggtgctcctaaagatgaagtgcgacacgcg
ggtgacctgggaaacatagttgctaacgccaatggtagtgtggcagaagcaacaattgtg
gacaaccagatatcactggatggtccaaacacagtagttggaagagcctttgtggttcat
gagcttgaggatgaccttggaaaaggtgggcatgaacttagtctaaccactggcaatgca
ggtggaagactggcatgcggtgtcgttggcttgactccggtatga

DBGET integrated database retrieval system