KEGG   Citrus clementina (mandarin orange): CICLE_v100304492mHelp
Entry
CICLE_v100304492m CDS       T02982                                 

Definition
(RefSeq) hypothetical protein
  KO
K01187  alpha-glucosidase [EC:3.2.1.20]
Organism
cic  Citrus clementina (mandarin orange)
Pathway
cic00052  Galactose metabolism
cic00500  Starch and sucrose metabolism
cic01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cic00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    CICLE_v100304492m
   00500 Starch and sucrose metabolism
    CICLE_v100304492m
Enzymes [BR:cic01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     CICLE_v100304492m
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31
Motif
Other DBs
NCBI-GeneID: 18031179
NCBI-ProteinID: XP_006419186
UniProt: V4S6B2
LinkDB All DBs
Position
Unknown
AA seq 226 aa AA seqDB search
HLYFPRSTFVGSGKYTAHWTGDNAATWNDLAYSIPSILNFGLFGIPMVGADICGFSGDTT
EELCRRWIQLGAFYPFARDHSAIGTIRQELYLWDTVAATARKVLGLRYRLLPYFYTLMYE
AHMKGTAVARPMFFSFPQDVKTYRIDTQFLIGKGVMVSPVLKSGAVSVDAYFPSGNWFDL
FNYSNSVSLNSGKQITLDAPPDHINVHVREGNILALQGEAMTTKSA
NT seq 678 nt NT seq  +upstreamnt  +downstreamnt
catttatactttccccgatcaacttttgttggctctggaaaatacacagctcattggact
ggagataatgccgccacatggaatgatttagcgtactcaattccgtccatcttaaatttt
ggactctttggaatcccaatggttggagccgatatttgtggcttttctggtgacacaact
gaagaactctgccgacggtggattcaactaggggctttttaccccttcgcaagagatcac
tctgctattggtacgatccggcaggaactctacctctgggacacggttgctgcaacagcc
aggaaagtgctcgggcttcgctacaggctactcccatacttttacacactaatgtatgaa
gcacatatgaaagggaccgccgttgcacgaccaatgttcttctcatttccccaagatgta
aaaacttacagaatagatacacaatttcttattggcaaaggtgttatggtgtcacctgta
ttgaagtcgggagcagtttcagtggatgcatacttccccagtggaaactggtttgatctt
ttcaactactcaaattcagtgtctctaaactcgggaaagcaaataacactagacgcacca
cctgatcatataaacgtacatgttcgggaaggtaacattttggccttgcaaggagaagcc
atgacaactaaatctgca

DBGET integrated database retrieval system