KEGG   Citrus clementina (mandarin orange): CICLE_v10030963mgHelp
Entry
CICLE_v10030963mg CDS       T02982                                 

Definition
(RefSeq) hypothetical protein
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
cic  Citrus clementina (mandarin orange)
Pathway
cic00564  Glycerophospholipid metabolism
cic01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cic00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    CICLE_v10030963mg
Enzymes [BR:cic01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     CICLE_v10030963mg
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 FAD_oxidored Pyr_redox_2 GIDA Pyr_redox Lycopene_cycl HI0933_like NAD_binding_8 FAD_binding_3 Pyr_redox_3
Motif
Other DBs
NCBI-GeneID: 18044303
NCBI-ProteinID: XP_006436493
UniProt: V4SPM7
LinkDB All DBs
Position
Unknown
AA seq 627 aa AA seqDB search
MSATRIRRFGAVLAAAAGGTSILLFTRPSIAGNDRGPSPDLVRSQIKNSKAVVPSRVVQE
SALIAANNSNPLDILVIGGGATGCGVALDAATRGLRVGLVEREDFSSGTSSRSTKLIHGG
VRYLEKAVFNLDYGQLKLVFHALEERKQVIKNAPHLSNALPCMTPCFDWFEVVYYWVGLK
MYDLVAGRHLLHLSRYYSAQESAELFPTLAMKAKDRSLKGAVVYYDGQMNDSRLNVGLAL
TAALAGAAVLNHAEVISLIKDEASNRIIGARIRNNLSGKEFDTYAKVVVNAAGPFCDSVR
KLADQNVQPMICPSSGVHIVLPDYYSPEGMGLIVPKTKDGRVVFMLPWLGRTVAGTTDSD
TVITLLPEPHEDEIQFILDAISDYLNVKVRRTDVLSAWSGIRPLAMDPSAKNTESISRDH
VVCEDFPGLVTITGGKWTTYRSMAEDAVNAAIKSGKLNPSNGCLTQNLRLVGGDGWDPSS
FTVLAQQYVRMKRTYGGKFVPGVMDTAVAKHLSHAYGIMAEQVAIIAQNEGLGKRLAHGY
PFLEAEVAYCARNEYCESAVDFVARRCRLAFLDTDAAGRALPRIIEIMATEHKWDKSRRK
QELQKAKEFLETFKSSKNKQFHDGKHK
NT seq 1884 nt NT seq  +upstreamnt  +downstreamnt
atgtccgccactcgcatccgccgcttcggcgccgtactcgccgccgctgccggcggaacc
tccatcctcctcttcacgcgtccctccatcgccggaaacgaccggggtccctcgcccgac
ctcgtcaggagccagatcaaaaattcgaaagccgttgttccgtcgagagtcgtccaggag
tctgctttgattgccgcaaacaacagtaatcctcttgacattcttgttattggcggtggc
gccactggatgcggcgttgcgctcgacgctgcgacgcgaggacttcgcgttggccttgtc
gagagagaggatttctcctccggaacgtcttcacgatccacgaaactgattcatggagga
gtccgctacttggagaaggctgtgtttaatcttgactatggtcaactgaagctggtattc
catgcacttgaggagcgtaaacaggttattaagaatgcaccgcatctcagcaatgctttg
ccttgcatgacaccctgttttgactggtttgaagtagtatactactgggtgggcttgaaa
atgtacgatttggtcgcaggaagacatctgttacatttatctagatattattctgcacaa
gagtctgctgagctgttccctactcttgcaatgaaggccaaagatagaagcttgaagggc
gcagtggtgtattatgatggtcagatgaatgactctcgtcttaatgttggactagcattg
actgctgcactggctggggctgcagtgcttaaccatgcagaagttatatcgctcattaaa
gatgaggctagtaaccggataattggtgctcgaattcgaaacaacctatccggcaaagaa
tttgatacctatgcaaaagttgttgtgaatgcggctgggccattttgtgactcagtgagg
aagttggctgaccaaaatgtacaacctatgatctgtcctagcagtggcgtgcatattgtt
ctccctgattactattctccagaaggaatgggtttgattgttcctaaaacaaaggatgga
cgtgtggttttcatgctgccatggttgggaagaacagttgctggcactacagattctgac
acagtcatcactttgcttccagaaccacatgaggatgagattcagtttatactggatgcc
atcagtgattaccttaatgttaaggtgcgacgcacagatgttctttctgcttggagtggc
attcgcccattggcaatggatccatcagcaaagaacactgaaagcatctccagggatcat
gtagtttgtgaagattttcctggtttggtcacaattactggtggaaagtggacaacttac
agaagcatggcagaagatgcagttaatgctgctataaagtctggaaagctgaacccaagc
aatggatgtttgactcagaacctgcggcttgttggtggagatggatgggatccttcatct
ttcacagttcttgctcaacaatacgtacggatgaagaggacatatggtggtaaatttgtt
cctggggttatggacactgctgttgcgaagcatttgtctcatgcatatggtataatggca
gaacaagtcgctatcatagctcagaatgaaggtttggggaaacggcttgcccacggatac
ccttttctagaggccgaagttgcttactgtgctcgaaacgagtactgtgaatctgctgta
gatttcgttgctaggagatgtcggcttgcattcctcgacactgatgcagcaggcagggca
ttgccccgcatcatagagataatggccactgagcacaaatgggataaatcaaggcggaag
caagagttgcagaaggccaaagaatttctagagactttcaaatcctcaaaaaacaagcaa
ttccatgatgggaaacacaaatag

DBGET integrated database retrieval system