KEGG   Citrus clementina (mandarin orange): CICLE_v10031155mgHelp
Entry
CICLE_v10031155mg CDS       T02982                                 

Definition
(RefSeq) hypothetical protein
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
cic  Citrus clementina (mandarin orange)
Pathway
cic00010  Glycolysis / Gluconeogenesis
cic00053  Ascorbate and aldarate metabolism
cic00071  Fatty acid degradation
cic00280  Valine, leucine and isoleucine degradation
cic00310  Lysine degradation
cic00330  Arginine and proline metabolism
cic00340  Histidine metabolism
cic00380  Tryptophan metabolism
cic00410  beta-Alanine metabolism
cic00561  Glycerolipid metabolism
cic00620  Pyruvate metabolism
cic00903  Limonene and pinene degradation
cic01100  Metabolic pathways
cic01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cic00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CICLE_v10031155mg
   00053 Ascorbate and aldarate metabolism
    CICLE_v10031155mg
   00620 Pyruvate metabolism
    CICLE_v10031155mg
  09103 Lipid metabolism
   00071 Fatty acid degradation
    CICLE_v10031155mg
   00561 Glycerolipid metabolism
    CICLE_v10031155mg
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    CICLE_v10031155mg
   00310 Lysine degradation
    CICLE_v10031155mg
   00330 Arginine and proline metabolism
    CICLE_v10031155mg
   00340 Histidine metabolism
    CICLE_v10031155mg
   00380 Tryptophan metabolism
    CICLE_v10031155mg
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    CICLE_v10031155mg
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    CICLE_v10031155mg
Enzymes [BR:cic01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     CICLE_v10031155mg
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-GeneID: 18043998
NCBI-ProteinID: XP_006438422
UniProt: V4TEF5
LinkDB All DBs
Position
Unknown
AA seq 546 aa AA seqDB search
MAARRIPLLLSRSFTSSSPTLFSRGRDSSLCRAAAAAAASCGYSTASSAAAAAEDPITPP
VKVDYTQLLINGQFVDSASGKTFPTLDPRTGDVITHVAEGEAEDVNRAVSAARKAFDEGP
WPRMTAYERSKIILRFADLLERHNDEIAALETWDNGKPFEQSAQTEVPMTTRLFRYYAGW
ADKIQGLTAPADGPYHVQTLHEPIGVAGQIIPWNFPLLMFAWKVGPALACGNTIVLKTAE
QTPLSALYVSKLLHEAGLPPGVLNIVSGYGPTAGAALASHMEVDKLAFTGSTATGKIVLQ
LAAKSNLKPVTLELGGKSPFIVCEDADVDKAAELAHYALFFNQGQCCCAGSRTFVHESVY
DQFVEKANALAMKRVVGDPFKGGIQQGPQIDSEQFEKILKYIRSGVDGGAKLETGGERLG
AKGYYIKPTVFTGVKDDMLIAKDEIFGPVQSILKYKDLDEVIQRSNASQYGLAAGVFTHN
LDTANTLMRALRVGSVWINCFDVFDAAIPFGGYKQSGQGREKGSYSLSNYLQVKAVVTAL
KNPAWL
NT seq 1641 nt NT seq  +upstreamnt  +downstreamnt
atggctgcaagaaggattccgcttttgctttcacgttcattcacgtcttcttcacctact
ctgttttcaagagggagggattctagtttgtgcagagctgctgctgctgctgccgcctcc
tgcggatacagcacggcttcttctgctgctgctgctgctgaagatccaattactccgcct
gttaaagttgattatactcagcttctaattaatggacaatttgttgattctgcatcaggc
aaaacgtttcccacattagaccccaggactggtgatgtgattactcatgtagctgaaggt
gaggctgaagacgtcaaccgagcagtttctgctgctcgcaaggcatttgatgaaggaccg
tggcctaggatgactgcttatgaaaggtcaaaaataattttgcgcttcgctgatttgctg
gaaaggcataatgatgaaattgcagcccttgagacttgggataacgggaagccattcgag
cagtctgcccagactgaagtaccaatgaccacgcgtttattccggtactacgctggttgg
gcagataagattcagggtctcactgctccagctgatggaccgtaccatgtgcaaaccttg
cacgaaccaattggtgtagcaggtcaaattatcccatggaactttccccttctcatgttt
gcttggaaagttgggcctgcattagcatgtggcaacactattgttcttaagacagcagag
cagactcccctctcagctctttatgtatcaaagctacttcatgaggctggacttcctcca
ggtgttctaaatatagtttcaggttatggtccaactgccggtgctgctcttgctagtcac
atggaagtggataagcttgctttcactggatcaactgcgaccggaaaaattgtacttcaa
ttggcagcgaaaagcaatcttaagccagtgacattagagcttggagggaaatctcctttt
attgtatgtgaagatgctgatgtagataaggccgctgagctggcccactatgctttattc
tttaatcagggacaatgctgttgcgctggttctcgtacttttgtacatgaaagtgtgtat
gatcaatttgtagagaaagcaaatgctcttgcaatgaaacgtgttgttggtgatccgttc
aagggaggaatccaacaaggacctcagattgattcagaacaatttgagaaaattctgaag
tacataagatccggtgttgatggtggagcaaaactcgagacaggaggggagagacttggc
gccaagggatactacatcaagcccacggttttcaccggtgtcaaggatgatatgttgata
gcaaaagatgagatatttggtccggtgcagtccatcttgaaatacaaggacctcgatgaa
gttattcaaagatcaaatgcatctcagtatggattggctgcaggggtgtttacgcacaac
ttggacactgctaatactctgatgcgtgcattgcgagtagggtcggtgtggattaactgc
tttgatgtgtttgatgctgcaattccctttggtggatacaagcaaagcgggcagggaaga
gagaagggttcttacagtctcagcaattacctgcaagtcaaggctgttgttactgccctt
aagaacccagcatggctttag

DBGET integrated database retrieval system