KEGG   Citrus clementina (mandarin orange): CICLE_v10031397mgHelp
Entry
CICLE_v10031397mg CDS       T02982                                 

Definition
(RefSeq) hypothetical protein
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
cic  Citrus clementina (mandarin orange)
Pathway
cic00010  Glycolysis / Gluconeogenesis
cic00020  Citrate cycle (TCA cycle)
cic00620  Pyruvate metabolism
cic01100  Metabolic pathways
cic01110  Biosynthesis of secondary metabolites
cic01200  Carbon metabolism
Module
cic_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:cic00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CICLE_v10031397mg
   00020 Citrate cycle (TCA cycle)
    CICLE_v10031397mg
   00620 Pyruvate metabolism
    CICLE_v10031397mg
Enzymes [BR:cic01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     CICLE_v10031397mg
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding
Motif
Other DBs
NCBI-GeneID: 18044409
NCBI-ProteinID: XP_006437680
UniProt: V4TH22
LinkDB All DBs
Position
Unknown
AA seq 479 aa AA seqDB search
MATLSPFLSKTPLSNTPTISFSSSISTPLKWKSITSFSPSGSSSSRSRRRIFIVQSKIRE
IFMPALSSTMTEGKIVSWIKSEGDVLSKGESVVVVESDKADMDVETFYDGILAAIVVPEG
ESAPVGAAIGILAETEAEVAQAKAKAASAGAAAPASHPVASTPVPAVSPPEPKKVAESAP
SVARKTVATPYAKKLLKQHKVDINSVVGTGPFGRITPEDVEKAAGIAPSKSVAPSAAPAA
LPKPAPAAAPAAPLLPGSTVVPFTTMQAAVSKNMIESLSVPTFRVGYPIITDALDALYEK
VKPKGVTMTALLAKAAAMALVQHPVVNASCKDGKSFTNNANINIAVAVAINGGLITPVLQ
DADKLDLYLLSEKWKELVEKARSKQLQPHEYNSGTFTLSNLGMFGVDRFDAILPPGQGAI
MAVGASKPTVAADADGFFSVKSKMLVNVTADHRIIYGADLATFLQTFSKIVENPESLTL
NT seq 1440 nt NT seq  +upstreamnt  +downstreamnt
atggctactctttccccattcctctcaaaaactcccctttcaaacacccccaccatttcc
ttctcttcttccatttccactcccctcaaatggaaatctatcacttcattctcaccgtcc
ggatcttcttcttcccgctctcgccgtcgaatcttcatcgtccaatccaaaatccgcgag
atcttcatgcccgccctcagttcgactatgaccgagggcaagatcgtctcgtggatcaag
tcagaaggcgacgttctttccaagggagaaagcgtcgtcgttgtggagtccgataaggct
gacatggatgtcgagaccttttatgacggcattctcgccgcaattgtcgtccccgaaggc
gagtccgctcccgttggtgccgctatcgggattcttgctgagacggaggcggaagttgct
caagccaaggccaaagccgcgtccgcaggggctgcagctcctgcttctcatcctgttgca
tccactcccgttccagctgtttccccacccgagccgaagaaagtggcggagtctgctccc
agtgtggccaggaagactgtggcgacgccttacgccaagaagttattgaagcagcacaaa
gtggacattaattcggtggttggaacggggccgtttggtagaattactcctgaagatgtg
gagaaggcggctggaattgctccttccaagagtgtggcaccctctgcggctccggctgct
ttgccaaaacctgcgccggcggcagcaccagcagctcctctacttcccggttctactgtg
gtgccttttacgacaatgcaggctgccgtttcaaagaatatgatcgagagtctttcggtt
cccactttccgtgttggatatccaattataacggatgctcttgatgcgctttatgagaag
gtgaagccaaagggtgtgacaatgactgcgctgttagcaaaagctgcagcaatggcgctt
gttcagcatccagttgttaatgccagctgtaaagatggcaagagttttactaacaatgct
aacatcaacattgcggtggccgtggctatcaatggtggcttgataacacctgttcttcag
gatgcagataagttggatctgtatttgttatctgaaaaatggaaagagcttgtggagaaa
gctcgatcgaagcaacttcagccccatgagtacaattcaggtactttcactctatccaac
ctgggtatgtttggagtggacagatttgatgctattcttcctccaggccagggggctatc
atggctgttggagcatcaaagccgactgtagctgctgatgcagatggtttcttcagtgtg
aaaagtaaaatgctggtgaatgtaaccgctgatcaccgaattatttatggtgctgacttg
gctacattcctacaaacattttcaaagattgttgagaatccagaaagcttgacattgtag

DBGET integrated database retrieval system