KEGG   Celeribacter indicus: P73_0222Help
Entry
P73_0222          CDS       T03575                                 

Definition
(GenBank) bifunctional malic enzyme oxidoreductase/phosphotransacetylase
  KO
K00029  malate dehydrogenase (oxaloacetate-decarboxylating)(NADP+) [EC:1.1.1.40]
Organism
cid  Celeribacter indicus
Pathway
cid00620  Pyruvate metabolism
cid01100  Metabolic pathways
cid01120  Microbial metabolism in diverse environments
cid01200  Carbon metabolism
Module
cid_M00169  CAM (Crassulacean acid metabolism), light
Brite
KEGG Orthology (KO) [BR:cid00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    P73_0222
Enzymes [BR:cid01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.40  malate dehydrogenase (oxaloacetate-decarboxylating) (NADP+)
     P73_0222
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PTA_PTB malic Malic_M AlaDh_PNT_C
Motif
Other DBs
NCBI-ProteinID: AJE44937
UniProt: A0A0B5DXF0
LinkDB All DBs
Position
224823..227087
Genome map
AA seq 754 aa AA seqDB search
MAKPKHTREEALRFHMEPRPGKFDITPSVPMTTQRDLSLAYSPGVAVPCEAIAEAPETAY
DYTNKGNLVAVISNGTAVLGLGNLGALASKPVMEGKSVLFKRFADVNSIDIELDTEDPEE
IIRAVKLMGPTFGGINLEDIKAPECFIIEQTLKEQMDIPVFHDDQHGTAVICAAGLINAL
HLAGKKIEECRIVLNGAGAAGIACLELVKAMGAQQDNCIMCDTKGVIHQGRTEGMNQWKS
AHAAVTDARTLAEAMVGADVFLGVSAKGAVTQEMVTSMAPNAVIFAMANPDPEITPEDVH
AVRDDVIVATGRSDYPNQVNNVLGFPYLFRGALDINARAINDEMKIACAEALAKLAREDV
PDEVALAYGRKLTFGRDYIIPTPFDPRLIYTIPPAVAQAGMDTGVARRPIIDMAGYAQDL
QARMDPTAQILQGLYARARQAQATMVFAEGDDSRVLRAAVAYVRGGFGRALVVGREDDVR
RKLQEEGLGEAYAELEIVNAAKTAHLQTYKDFLYARLQRSGHDQKDIHRLAARDRHAFSA
LMLAHGHADGLVTGATRKSAHVLDRINTVFDATAKDGAVGITALLHKGRIIFIADTLVHE
WPEEEDLADIATAGAQVARAMGIEPRVAFVSFSTFGYPVSERASKMHLAPQVLDRRGVDF
EYEGEMTVDVALNPEAMAAYPFCRLTGPANILVVPARHSASISVKLMQEMAGATVIGPIL
TGVDKPIQICSTVSTVNDILNMAILAACKVGQTA
NT seq 2265 nt NT seq  +upstreamnt  +downstreamnt
atggcgaaacccaaacacacccgcgaagaagcgctcagatttcacatggaaccgcgcccc
ggcaagttcgacatcacgccgagcgtgccgatgacgacgcagcgcgacctgtcgctggcc
tattctccgggtgtggccgtgccctgcgaagcgatcgccgaagcgccggaaaccgcctac
gattacacgaacaagggcaatctggtcgcggtgatctccaacggcaccgccgttctcggc
ctcggcaatctcggcgcattggcctccaaacccgtgatggaggggaaatccgtcctcttc
aaacgctttgccgacgtgaattccatcgacatcgaactcgataccgaggatcccgaggaa
attatccgcgcggtgaaactcatggggccgaccttcggcggcatcaacctcgaggatatc
aaggcgcccgagtgcttcatcattgagcagacgcttaaggaacagatggacattcccgtc
tttcacgacgaccagcacggcaccgcggtcatctgcgccgccggcctcatcaacgcgctg
cacctggcgggcaagaagatcgaggagtgcaggatcgtcctcaacggtgcgggcgcggcg
ggcatcgcctgtctcgaactggtgaaggcgatgggcgcacagcaggacaactgcatcatg
tgcgacaccaagggcgtgatccatcagggccggaccgagggcatgaaccagtggaaatcc
gcccacgccgccgtcaccgacgcgcgcaccctggccgaggcgatggtcggcgccgacgtc
ttcctcggcgtgtcggcgaaaggtgcggtgacgcaggagatggtgacatccatggcgccg
aacgccgtcatcttcgccatggccaatcccgatccggaaatcacgcccgaggatgtccat
gcggtgcgcgacgacgtgatcgtcgccaccggccgctcggactatcccaaccaggtcaac
aacgtactgggctttccctatctcttccgcggcgcgctcgacatcaacgcccgcgcgatc
aacgacgagatgaagatcgcctgcgccgaggcgctcgccaaactcgcacgcgaggacgtg
cccgacgaggtcgcgctcgcctatgggcgcaaactgaccttcgggcgggactacatcatc
ccgacccccttcgatccgcgtctcatctacacgattccgcccgccgtcgcgcaggccgga
atggacaccggcgttgcccggcgtccgatcatcgacatggcgggctatgcccaggatctt
caggcgcggatggaccccaccgcccagatcctccagggcctctatgcccgcgcgcgccag
gcgcaggccacgatggtctttgccgagggggacgattcgcgcgtgctgcgggccgctgtc
gcctatgtccggggcggcttcggccgtgcccttgtcgtgggacgcgaggacgacgtgcgc
cggaaacttcaggaggaaggtctcggcgaagcctatgcggagctcgagatcgtcaacgcc
gccaaaacggctcaccttcagacctacaaggatttcctctacgcgcgccttcagcgttcg
ggccacgaccagaaggacattcaccgcctcgccgcgcgggaccgccatgccttctccgcg
ctcatgctggcccatggccatgccgacggactcgtcaccggcgcgacccgtaaatccgcc
catgtgctcgaccggatcaacaccgtcttcgacgcgaccgcaaaggacggcgcggtgggg
atcaccgcgctcctgcacaagggccggatcatcttcatcgcggacacgctggtgcatgag
tggccggaggaggaggatctcgcagatatcgccacggccggggcgcaggtcgcgcgggcg
atggggatcgagccgcgcgtcgccttcgtctccttctcgaccttcggctatcccgtgtcc
gaacgcgcgagcaagatgcaccttgcgccgcaggttctcgaccggcgcggcgtcgatttc
gaatacgagggcgagatgaccgtcgatgtcgccctgaacccggaggcgatggcggcctat
cccttctgccggctcaccggaccggccaacatcctggtcgtgcctgcgcgccattccgcc
tcgatctcggtgaagctcatgcaggagatggccggtgcgacggtgatcggtccgatcctg
accggcgtagacaagccgatccagatctgttcgaccgtctcgaccgtcaacgacatcctg
aacatggcgatcctcgccgcctgcaaggtagggcagaccgcatag

DBGET integrated database retrieval system