KEGG   Celeribacter indicus: P73_0616
Entry
P73_0616          CDS       T03575                                 

Definition
(GenBank) sensor histidine kinase ChvG
  KO
K14980  two-component system, OmpR family, sensor histidine kinase ChvG [EC:2.7.13.3]
Organism
cid  Celeribacter indicus
Pathway
cid02020  Two-component system
Brite
KEGG Orthology (KO) [BR:cid00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    P73_0616
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:cid01001]
    P73_0616
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:cid02022]
    P73_0616
Enzymes [BR:cid01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.13  Protein-histidine kinases
    2.7.13.3  histidine kinase
     P73_0616
Protein kinases [BR:cid01001]
 Histidine kinases
  OmpR family
   P73_0616
Two-component system [BR:cid02022]
 OmpR family
  ChvG-ChvI (acidity sensing)
   P73_0616
SSDB
Motif
Pfam: Sensor_TM1 HATPase_c HisKA HATPase_c_5 HAMP Stimulus_sens_1 HATPase_c_2
Other DBs
NCBI-ProteinID: AJE45331
UniProt: A0A0B5DX51
LinkDB
Position
622133..623863
AA seq 576 aa
MVFSPRMDRPAKRRRENADVVLGDDWIAPRTSDADLRARREGRRFIAINRSPLAQKIVTF
NLVAIILMVAGILYLNPFRDSLVTQREMAMVTEAALIADMIEVYAGEDGVPGGMASAEGA
RRIAEVIAIPLREHVYVYDREGALIASTEGLPRVRPTNVAGLQDERRTTVISDFLNNIWS
AITPARSAENAVIAEDAARVAPLVARTLGNEINVDTSVDAHGLTVFTVAAPITREVDGRV
ETLGVVGLVSGEGEIDELVRVEREQILQVFVIAFLVSIGLSLVLASTIANPLADLAAAAE
IGRDKNSRKLAPGRVRIPDLSGRPDEIGRLSSALRGMVSALYDRIDANEQFAADVAHEIK
NPLASLRSAVGSLRMIRKEEHREKLLDVIEHDVRRLDRLVSDISNASRLDSELVKEDEEE
FDLLTMLGNLIDYLSQEAQRNGVEFISDLPDTPIVISGLEARLAQVFVNLITNAISFCEE
GDAIRVWVRKRDSRVLVVVEDTGPGIPDQALSKIFRRFYSERPAGQFGNNSGLGLAISKQ
IVEAHGGVIWAENIRPTDADITSEPLGARFVVGLPV
NT seq 1731 nt   +upstreamnt  +downstreamnt
atggtcttttccccccgcatggacaggccggcgaaacgcaggcgcgagaacgcggatgtc
gtgctcggcgatgactggatcgcgccgcgcacctccgacgccgacctgcgcgcgcggcgc
gaggggcgccgcttcatcgcgatcaaccgctccccgctggcgcagaagatcgtcaccttc
aacctcgtcgccatcatcctgatggtcgcgggcatcctctacctcaaccccttccgcgac
agcctcgtgacccagcgcgagatggcgatggtgacggaggccgcgctgattgccgacatg
atcgaggtctacgccggcgaggacggtgtgcccggcggcatggccagcgcggagggagcc
cgcaggatcgcggaggtgatcgccatccccttgcgcgagcatgtctacgtctatgaccgc
gagggcgcgctcatcgcctcgacagagggcctcccgcgcgtgcggccgaccaatgtcgcc
ggccttcaggacgaacggcggacgaccgtcatctccgatttcctcaacaatatctggtcc
gcgatcacccccgcgcggtccgcggagaacgccgtgatcgccgaggacgcggcgcgcgtc
gccccgctcgttgcacggacgctcggaaacgagatcaatgtcgacaccagcgtcgacgcc
catggcctgacggtcttcaccgtggccgcgccgatcacgcgcgaggtggacggccgggtg
gagacgctcggcgtcgtcggcctcgtctccggcgagggggagatcgacgaactcgtccgg
gtggagcgcgaacagatcctccaggtcttcgtcatcgccttcctcgtctccatcgggctg
agcctcgtgctcgcctccaccatcgccaatccgctcgccgatctcgccgccgccgccgaa
atcggccgggacaagaacagccgcaaactcgctccggggcgcgtgcgcatccccgatctc
tccggccgccccgacgagatcggccggctctcctccgcgctgcgcggcatggtctccgcg
ctctacgaccggatcgacgcgaacgaacagttcgccgccgacgtcgcccacgagatcaag
aaccccctcgcctccctgcgctccgccgtcgggtcgctgcggatgatccggaaggaggag
catcgcgagaagctgctcgacgtgatcgagcacgacgtgcgccgcctcgaccggctggtc
tccgacatctccaacgcctcccggctcgacagcgagctcgtgaaggaggacgaggaggaa
ttcgacctgctgaccatgctcggcaacctcatcgactacctgtcgcaggaggcgcagcgc
aatggggtcgaattcatctccgacctgcccgacacgccgatcgtcatctcggggctcgag
gcgcggctcgcccaggtcttcgtcaacctcatcaccaacgcgatctccttctgcgaggag
ggcgacgcgatccgcgtctgggtgcgcaagcgcgacagccgggtgctcgtggtggtggag
gacaccggccccggtatccccgaccaggccctctcgaagatcttcaggcgcttctactcc
gaacgtcccgccgggcagttcggcaacaactccggcctcggtctcgcgatttccaagcag
atcgtggaagcgcacggcggcgtcatctgggcggagaacatccgcccgacggatgccgac
atcacctccgaacctctcggcgcgcgcttcgtcgtcggcctgccggtctga

DBGET integrated database retrieval system