KEGG   Celeribacter indicus: P73_0821Help
Entry
P73_0821          CDS       T03575                                 

Gene name
glpD
Definition
(GenBank) glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
cid  Celeribacter indicus
Pathway
cid00564  Glycerophospholipid metabolism
cid01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cid00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    P73_0821 (glpD)
Enzymes [BR:cid01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     P73_0821 (glpD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C NAD_binding_8 Pyr_redox_2 Pyr_redox
Motif
Other DBs
NCBI-ProteinID: AJE45536
UniProt: A0A0B5DXR1
LinkDB All DBs
Position
complement(813345..814940)
Genome map
AA seq 531 aa AA seqDB search
MAEIDGTGISDLFIIGGGINGCGIARDAAGRGLSVTLAEMGDLASATSSASTKLFHGGLR
YLEYFELRLVHEALKEREVLLRAMPHISWPMRFVLPYHEDMRFESTTPTSRLLGLTMPWL
RGQRPAWLIRLGLFLYDTLGGRKILPGTQTLSLAGTPEGAPLQERFERAYEYSDCWVQDS
RLVALNARDAAARGAAILTRTKVVRAAREGALWRIETEDMETGGTATHSARLLVNAGGPW
VGEILHDRIDLPSREGVRLVRGSHIVTRRLYDHDKCYFFQGTDGRIIFAIPYEGDFTLIG
TTEADHPAPSQPPVCTPEEQRYLLDFANRYFRTPVTEADIVWTYSGVRPLHDEGAASNTA
ATRDYTLKFAAGDGAPLLNVFGGKITTYRRLAEAALEKIGTHLTVTRGPWTAGAPLAGGD
FPVDGAAALVTDLRGRFPFLTEAWAWRLVRSYGTEAVLILGTAATAGELGEAFGATLTEA
EVRWLMRHEFARRAEDVVWRRTKLGLRLDPAQVAALDRWMTAERRAEEAAE
NT seq 1596 nt NT seq  +upstreamnt  +downstreamnt
atggccgagatcgacggcaccggcatttcagacctgttcatcatcggcggcggcatcaat
ggctgcggcatcgcgcgcgacgcggcggggcgcggtctgtccgtgaccctcgcggagatg
ggagatctcgcctccgcgacctcctccgcctccacgaagctctttcacggcgggctgcgc
tacctcgaatatttcgagctgcggctggtccacgaggcgctgaaggaacgcgaggttctg
ctgcgcgccatgccgcatatcagttggcccatgcgctttgtcctgccctatcacgaggac
atgcgcttcgagagcaccacccccacctcgcgcctgcttggcctgacgatgccctggctc
aggggacagcggccggcctggctcatccgcctcgggcttttcctctacgacacgctgggc
gggcggaagatcctgcccggcacgcagaccctctctctcgcaggcacgccggagggcgcg
ccgcttcaggagcggttcgaacgggcttacgaatattccgactgctgggtgcaggattcg
cgcctcgtcgcgctcaacgcccgcgacgccgcggcgcgcggcgcggcgatcctcacgcgc
acgaaggtcgtccgcgcggcccgcgagggcgcgctgtggcggatcgagacggaagacatg
gagaccggcgggacggcgacgcattccgcgcgcctgctcgtgaacgccggcgggccctgg
gtcggagagatcctgcatgacaggatcgacctgccctcccgcgagggcgtgcgcctcgtg
cgcggcagccatatcgtcacccggcgcctctacgatcacgacaagtgctatttcttccag
ggcaccgacgggcgcatcatcttcgcgatcccctacgagggcgacttcaccctgatcggc
acgaccgaggcggatcatccggccccgtcgcagccgccggtctgcacgccggaggagcag
cgctatctccttgatttcgccaaccggtatttcaggacgcccgtcacggaggcggacatc
gtctggacctattccggggtgcgcccgctccatgacgagggtgcggcgtccaacacggcg
gcgacgcgggactacacgctgaaattcgccgccggggacggcgctccgctgctcaatgtc
ttcggcggcaagatcaccacctatcgccgcctcgcggaggccgcgctggagaagatcggg
acgcacctgaccgtcacccgcggcccctggaccgccggggcaccgcttgcgggcggggat
ttcccggtggacggggccgcggcgctggtgacggatctccggggtcgctttccgttcctg
acggaggcatgggcatggcggctcgtgcgcagctacgggaccgaggcggtgctgatcctc
ggcacggccgcgacggccggggaactgggcgaggccttcggcgcgacgctgacggaggcg
gaggtgcgctggctgatgcgccacgaattcgcccggcgggcggaagacgtcgtctggcgg
cgcacgaaactcggcctgcggctcgacccggcacaggttgccgcgctggaccgctggatg
acggccgaacggcgcgcggaggaggccgcggaatga

DBGET integrated database retrieval system