KEGG   Celeribacter indicus: P73_1541Help
Entry
P73_1541          CDS       T03575                                 

Definition
(GenBank) 4-aminobutyrate aminotransferase
  KO
K00823  4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
cid  Celeribacter indicus
Pathway
cid00250  Alanine, aspartate and glutamate metabolism
cid00410  beta-Alanine metabolism
cid00640  Propanoate metabolism
cid00650  Butanoate metabolism
cid01100  Metabolic pathways
cid01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:cid00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    P73_1541
   00650 Butanoate metabolism
    P73_1541
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    P73_1541
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    P73_1541
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:cid01007]
    P73_1541
Enzymes [BR:cid01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     P73_1541
Amino acid related enzymes [BR:cid01007]
 Aminotransferase (transaminase)
  Class III
   P73_1541
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: AJE46256
UniProt: A0A0B5DZV1
LinkDB All DBs
Position
complement(1544008..1545297)
Genome map
AA seq 429 aa AA seqDB search
MLEKTENAGLETRRKAALARGVGVLTDHYAVSARNAEIRDADGNRLIDFAAGIAVLNTGH
RHPKVMAAVRAQLDAFTHTCHQVVPYESYVRLAERLNALAPGDFAKKALFVTTGAEALEN
AVKIARAATGRSAVITFDGGFHGRTFMTMSMTGKVAPYKLGFGPMAADVFHAPFPNALHG
ISVEDSLRALEALFKADVDPARVAAIVFEPVQGEGGFNPAPKDFVTRLRALCDAHGIVMV
ADEVQTGFARTGTLFAMEAHGVAPDLTTMAKSLGGGLPISAVVGRAELMDAAAPGGLGGT
YGGNPLGIAAANAVLDVIEEEDLCARATALGSVLKARLRAMQAAFLPELAEVRGPGFMIA
AEFMDEAGTPLPELAEAIRRAALDRGLLLLTCGVHGNVIRFLAPLTIEDDVFAEALDILE
AAAKAVKGA
NT seq 1290 nt NT seq  +upstreamnt  +downstreamnt
atgttggaaaagaccgagaatgccgggctcgagacccgtcgcaaggcggcgctggcgcgc
ggcgtgggcgtgctcaccgatcattacgcggtgagcgcccggaacgcggagatccgggat
gccgacggcaaccgcctcatcgacttcgccgcgggcatcgccgtgctgaacaccggccac
cggcacccgaaggtgatggccgccgtgcgcgcgcagctcgacgccttcacccacacctgc
caccaagtcgtgccctatgaaagctacgtgcgccttgccgagcggctgaacgccctcgcg
ccgggggacttcgcgaaaaaggcgctcttcgtcacgaccggcgcggaggcgctcgagaac
gcggtgaagatcgcgcgcgccgcgaccggccgctccgccgtgatcacctttgacggcggg
ttccacgggcgcaccttcatgaccatgtcgatgaccggcaaggtcgcgccctacaagctc
ggcttcggccccatggcggcggacgtgttccatgcgcccttccccaacgcgctgcacggc
atttccgtggaggacagccttcgcgcgctcgaggcgctgttcaaggcggatgtggacccc
gcccgcgtcgccgccatcgtcttcgaacccgtgcagggcgaaggcggcttcaacccggcg
ccgaaggacttcgtcacccgcctgcgcgcgctctgcgacgcccatgggatcgtgatggtg
gccgacgaggtgcagacgggctttgcgcgcaccggcaccctctttgcgatggaggcccac
ggtgtcgcgcccgacctgacgaccatggccaaaagcctcggcggcgggctcccgatctcc
gccgtggtgggccgtgccgagctgatggatgccgccgcgcccggcgggctgggcggcacc
tatggcggcaatcctctcggcatcgcggcggccaacgccgtgctcgacgtgatcgaggag
gaagacctctgcgcccgcgccaccgcgctcggcagcgtgctcaaggcccggctccgggcg
atgcaggcggcctttctccccgagcttgccgaggtgcgcggtcccggcttcatgatcgcc
gccgagttcatggacgaggccggcacgccgctgcccgagcttgccgaggcgatccgccgc
gccgcgctcgaccgcgggctcctgctgctgacctgcggggtgcatggcaacgtgatccgc
ttcctcgcgccgctcaccatcgaggacgatgtcttcgccgaggcgctggacattctcgaa
gcggccgccaaagcggtgaagggagcctga

DBGET integrated database retrieval system