KEGG   Celeribacter indicus: P73_2027Help
Entry
P73_2027          CDS       T03575                                 

Definition
(GenBank) iron(III) ABC transporter iron (III)-binding protein
  KO
K02012  iron(III) transport system substrate-binding protein
Organism
cid  Celeribacter indicus
Pathway
cid02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:cid00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    P73_2027
Transporters [BR:cid02000]
 ABC transporters, prokaryotic type
  Mineral and organic ion transporters
   Iron(III) transporter
    P73_2027
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SBP_bac_6 SBP_bac_11 SBP_bac_8 SBP_bac_1
Motif
Other DBs
NCBI-ProteinID: AJE46742
UniProt: A0A0B5E2R9
LinkDB All DBs
Position
complement(2020682..2021851)
Genome map
AA seq 389 aa AA seqDB search
MGAIPRVSSRLALVVAAAAGSLLTGATEASAQAAEQNPHIEELIEQARQEGSLYLNWSDY
GDIIGDWVDGYLETYGLKGEIEVVHTPNPNGTAAFLQLEEEFSAGRPAHTDIMEGAELRT
ALGISGFRRSGGFLADIDYASLPNVAPAMVKGDGKTVVYAHIMPGISYNTNTVAPEDLPK
NIEDYTDPTFLNEYNVASTGQASGFDFLFTEQTWGFERACEFTTRLGAGIAGLIEPHEAT
RIASGEFDMLIFDQGLRPLQLAASGAPVAITYPEGYTFRRAQHFSIPENAEHKAAAQLFI
NYMLSPEAQQILYDKYRIDSHDRDGSLSAGTLAQVSEQTGTPTDIDIAFIEQSYMDEIRP
AIPLMRGMLTGEYGPDDCAGLAEQVKDGN
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
atgggcgcgattccgcgcgtttccagtcgtctggcgctcgtcgtggccgccgcggcagga
tccttgctcacgggcgccaccgaggcatcggcgcaggcagccgagcagaacccgcacatc
gaagaacttatcgagcaggccaggcaggagggcagcctctacctgaactggagcgactac
ggcgacatcatcggcgactgggtcgacggctatctggagacctacggcctgaaaggtgag
atcgaggtcgtccacacgcccaacccgaacggcacggcggccttcctgcaactcgaggag
gagttctccgccgggcgcccggcccataccgatatcatggagggggccgaactgcgcact
gctctcggcatttccggcttccgacggtccggcggtttcctcgccgacatcgactatgcc
agcctcccgaatgtcgcaccagccatggtcaagggcgacggcaagacggtcgtctatgcg
catatcatgcccggcatcagctacaatacgaacacggtggcgcccgaggatctgccgaaa
aacatcgaagactataccgacccgaccttccttaacgagtacaacgtcgcctcgaccggc
caggcctcgggtttcgattttctcttcaccgagcagacatgggggttcgagcgggcctgc
gagttcacgacccgcttgggcgccggcatagccggactgatcgaaccgcatgaggcgacg
cgcatcgcctccggcgaattcgacatgctgatcttcgaccagggcctgcgcccgcttcaa
ctggccgcgtccggagcgccggtcgcaatcacctatcccgaaggttatacctttcgccgt
gcccagcatttctcgattcccgagaatgccgaacacaaggcggcagcgcagcttttcatc
aattacatgctcagccccgaggcgcagcagatcctctacgacaagtataggatcgacagc
cacgaccgtgacggatcgctgagcgcgggcaccctcgcccaagtgagcgaacagacaggc
acgcccaccgacatcgacatcgccttcatcgaacaatcctacatggacgagatccgcccg
gcgatccccctgatgcgcgggatgttgaccggcgaatacggccccgacgactgcgcagga
ctggccgaacaggtcaaggacgggaactga

DBGET integrated database retrieval system