KEGG   Celeribacter indicus: P73_3612Help
Entry
P73_3612          CDS       T03575                                 

Definition
(GenBank) thymidine kinase
  KO
K00857  thymidine kinase [EC:2.7.1.21]
Organism
cid  Celeribacter indicus
Pathway
cid00240  Pyrimidine metabolism
cid01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cid00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    P73_3612
Enzymes [BR:cid01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     P73_3612
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TK AAA_22 AAA_14 AAA_30 DUF2075
Motif
Other DBs
NCBI-ProteinID: AJE48327
UniProt: A0A0B5E7Q5
LinkDB All DBs
Position
3698670..3699257
Genome map
AA seq 195 aa AA seqDB search
MAKLYFQYSTMNAGKSTLLLQASYNYRERGMETYLITARLDDRAGEGRIASRIGIGEVAD
TFAEGEDLFAKIAARIARNDVACIFIDEAQFLSRAQVWQLARVVDDLKVPVMCYGLRVDF
RGHLFPGSAALLALADEMREIRTICHCGKKATMVVRMAEDGRVLTEGAQVEIGGNERYVS
LCRKHWREAVGDRPA
NT seq 588 nt NT seq  +upstreamnt  +downstreamnt
atggcaaagctctacttccagtattcgaccatgaacgcggggaaatcgaccctgctgctt
caggcatcctacaactatcgcgaacgcgggatggagacctatctcatcaccgcgcgcctc
gacgaccgcgccggcgaggggcggatcgcgagccggatcggcatcggggaggtggcggac
accttcgcggagggagaggatcttttcgccaagatcgccgcccggatcgcccgaaatgac
gttgcgtgcatcttcatcgacgaggcgcagttcctgagccgcgcgcaggtctggcaactg
gcccgcgtggtcgatgacctgaaggtgccggtcatgtgctacgggctgcgggtggatttc
cggggtcatctctttcccggttcggccgccctgctggcgctggccgacgagatgcgggag
atccgcacgatctgccattgcggcaagaaggcgacgatggtcgtgcgcatggccgaggac
gggcgtgtgctgaccgagggcgcgcaggtcgagatcggcggcaacgaacgctacgtctcg
ctctgccggaagcattggcgcgaggcggtgggggaccgccccgcgtga

DBGET integrated database retrieval system