KEGG   Celeribacter indicus: P73_4467Help
Entry
P73_4467          CDS       T03575                                 

Definition
(GenBank) aldehyde dehydrogenase
Organism
cid  Celeribacter indicus
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh KRE1
Motif
Other DBs
NCBI-ProteinID: AJE49182
UniProt: A0A0B5EA72
LinkDB All DBs
Position
pP73A:complement(89534..91021)
Genome map
AA seq 495 aa AA seqDB search
MTVHDIIENPEKFYIDGAWTAPSGTAQITVLNSATEEVFEVVAEAQEADVNRAVEAARRA
FDRGPWPRMSHEERADYLRRLADELDKRAERHARIWTTESGVLHSIAAARMGSIAATYRY
YADLAATYPFQERHPSASGGELALLVREPVGVVGAIVPWNGTPGLITSKVAPALLAGCTV
IVKASPEAPGSAYILAEAAHAAGLPEGVVNILTADREVSEKLVAHPGVDKIAFTGSTVAG
MKIGAICGGRIARQTLELGGKSPALILDDYDVETAARTITEKATFLTGQVCASLTRILVS
RSRHDDLVEALSSNFATVNVGDPFESACQMGPLAMSRQRDRVEGYIAKGKDEGAVLATGG
GRPAHLNRGYFVEPTVFGNVENSFTIAREEIFGPVLSVIPVDGEREMIDVANDTNFGLNA
SVFTNDFDKAYSVAREIRSGTVGQNSYRAELGLAFGGFKQSGLGREGGTEGLHPYLETKV
VVLDGMPSNAGRIAG
NT seq 1488 nt NT seq  +upstreamnt  +downstreamnt
atgaccgtccatgacatcattgaaaacccggaaaaattctacatcgacggcgcctggacc
gctccgtcgggcacggcgcagatcaccgtcctgaactccgcgacagaggaggtcttcgag
gtggtggcggaggcgcaggaagcggatgtgaaccgcgccgtcgaggccgcccgccgcgcc
ttcgaccggggcccgtggccgcgcatgtcccatgaggagcgggcggattacctgcgtcgc
ctcgccgacgaactcgacaagcgtgccgagcggcatgcgcggatctggacgaccgagtcg
ggcgtgctgcattccatcgcggcggcgcggatgggctccatcgccgcgacctatcgctat
tatgccgacctggccgcgacctatccgttccaggaacggcacccctccgcctcgggcggg
gagctggcgctcctggtgcgggaacccgtgggcgtggtgggggcgatcgtgccctggaac
ggcacgcccggcctgatcacgagcaaggtggcgccggcgctcctcgcgggctgcaccgtg
atcgtgaaggcctcgcccgaggcgcccggctccgcctatatccttgccgaggcggcccat
gccgccggcctgcccgagggcgtggtcaacatcctcaccgccgaccgcgaggtctccgaa
aagctcgtcgcccatcccggcgtggacaagatcgccttcaccggctcgaccgtggcggga
atgaagatcggcgcgatctgcggcgggcgcatcgcgcggcagacgctcgaactcggcggc
aagtcccccgcgctgatcctcgacgattacgacgtggagacggcggcccgcacgatcacg
gaaaaggcgaccttcctcaccgggcaagtctgtgcctcgctgacccgcatcctcgtgtcg
cggtcgcgccatgacgatctcgtggaggcgctgagcagcaatttcgccacggtgaacgtg
ggcgaccccttcgagagcgcctgccagatggggccgcttgccatgagccgccagcgcgac
cgggtcgagggctatatcgccaagggcaaggacgagggcgcggtgcttgccaccgggggc
ggccgcccggcgcatctcaaccgcggctatttcgtcgagccgaccgtcttcggcaacgtc
gagaacagcttcaccatcgcgcgcgaggagatcttcggtccggtgctgtcggtcattccg
gtggacggggaacgcgagatgatcgacgtggcgaacgacacgaatttcggcctgaacgcc
tccgtcttcaccaacgatttcgacaaggcctattcggtcgcgcgcgagatccgctccggc
acggtcgggcagaacagctatcgtgccgagcttggcctcgccttcggcgggttcaagcaa
tcgggcctcgggcgcgagggcggcaccgaggggctgcacccctatctcgagacgaaggtg
gtggtgctcgacgggatgccgtcgaacgcgggccgcatcgccggctga

DBGET integrated database retrieval system