KEGG   Citrobacter sp. CRE-46: AN232_06090Help
Entry
AN232_06090       CDS       T05520                                 

Definition
(GenBank) glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
cie  Citrobacter sp. CRE-46
Pathway
cie00564  Glycerophospholipid metabolism
cie01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cie00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    AN232_06090
Enzymes [BR:cie01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     AN232_06090
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_oxidored Pyr_redox_2 NAD_binding_8 FAD_binding_2 3HCDH_N Lycopene_cycl GIDA
Motif
Other DBs
NCBI-ProteinID: AWS94828
UniProt: A0A2Z3X1F2
LinkDB All DBs
Position
complement(1219234..1220742)
Genome map
AA seq 502 aa AA seqDB search
METKDLIVIGGGINGAGIAADAAGRGLSVLMLEAQDLACATSSASSKLIHGGLRYLEHYE
FRLVSEALAEREVLLKMAPHIAFPMRFRLPHRPHLRPAWMIRIGLFMYDHLGKRTSLPGS
TGLRFGADSVMKPEIVRGFEYSDCWVDDARLVLANAQMVVRKGGEVLTRTRATSARRENG
LWIVEAEDIDTGKKHTWQARGLVNATGPWVKEFFDDGMHLPSPYGIRLIKGSHIVVPRVH
TQKQAYILQNEDKRIVFVIPWMDEFSIIGTTDVEYKGDPKAVKIDESEINYLLKVYNAHF
KKQLSRDDIVWTYSGVRPLCDDESDSPQAITRDYTLDIHDENGKAPLLSVFGGKLTTYRK
LAEHAMEKLSSYYQGIGPAWTKECILPGGDIGGDREDYAAKLRRRYPFLTESLARHYSRT
YGSNTEWIIGDATSIAELGEDFGHEFYEAELKYLVEHEWVRRAEDALWRRTKEGMWLNAE
QQSHMTQWLTEYIEKHQLSLAS
NT seq 1509 nt NT seq  +upstreamnt  +downstreamnt
atggaaaccaaagatctgattgtgataggtggaggcatcaacggtgccggtatcgcggca
gatgccgctggacgcggtttatccgtgctgatgctggaggcacaggatttagcctgcgcc
acctcctccgccagctccaaactcatccacggtggcctgcgctacctggaacactacgaa
ttccgcctggtgagcgaggcgctggcagaacgtgaagtgctgttgaaaatggcgccgcat
atcgccttcccgatgcgctttcgtctgccccatcgcccgcatctgcgtccggcatggatg
atccgtattggtttgtttatgtacgatcatctgggcaaacgcaccagtttgccgggttct
actggtttgcgttttggcgcggattccgtgatgaaacctgagattgtgcgcggtttcgaa
tattctgactgctgggtagacgatgcgcgtctggttttggcaaacgcccaaatggtcgtg
cgcaaaggcggagaagtattaacccgcacccgcgccacctccgctcgccgtgaaaacggc
ctgtggatcgttgaagccgaagatatcgataccggcaaaaaacacacctggcaggcgcgc
ggtctggtcaatgccaccggtccgtgggtgaaagagttctttgatgacggcatgcatctg
ccttcgccgtacggtattcgtctgattaaaggtagccacatcgtggtgccgcgcgtacat
acccagaagcaagcgtatattctgcaaaatgaagataaacgtattgtgtttgttatccca
tggatggacgaattctcgatcatcgggacgactgacgtcgaatacaaaggcgacccgaaa
gcagtgaaaattgatgaaagcgaaatcaattacctgctgaaggtctacaacgcgcacttt
aagaaacagcttagccgtgacgatatcgtctggacttactcgggcgtgcgtccgctatgc
gatgacgagtccgactcgccgcaggctattacccgtgattacacgctggatatccacgac
gaaaacggcaaagcgccgctgctgtcggtctttggcggtaagctgacaacctaccgtaag
ctggccgagcacgcgatggaaaaactgtcgtcatactatcagggcattggccccgcatgg
accaaagagtgcatcctgcctggcggtgatattggcggcgatcgcgaagattacgcggca
aaactgcgccgtcgctatccattcctgaccgaatcgctggcacgccattattcgcgtacc
tatggcagcaatactgaatggattatcggcgacgccacgtcaatcgccgagttaggcgaa
gacttcggccatgagttctatgaggccgagctgaagtatctggttgagcatgagtgggtg
cgtcgcgcagaagatgcgctgtggcgtcgtacgaaagaaggcatgtggctgaatgccgaa
cagcagtcccacatgacccaatggctgacggagtatatcgagaagcaccagctgtcgctg
gcctcctga

DBGET integrated database retrieval system