KEGG   Citrobacter sp. CRE-46: AN232_10165Help
Entry
AN232_10165       CDS       T05520                                 

Definition
(GenBank) 4-aminobutyrate--2-oxoglutarate transaminase
  KO
K07250  4-aminobutyrate aminotransferase / (S)-3-amino-2-methylpropionate transaminase / 5-aminovalerate transaminase [EC:2.6.1.19 2.6.1.22 2.6.1.48]
Organism
cie  Citrobacter sp. CRE-46
Pathway
cie00250  Alanine, aspartate and glutamate metabolism
cie00280  Valine, leucine and isoleucine degradation
cie00310  Lysine degradation
cie00410  beta-Alanine metabolism
cie00640  Propanoate metabolism
cie00650  Butanoate metabolism
cie01100  Metabolic pathways
cie01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:cie00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    AN232_10165
   00650 Butanoate metabolism
    AN232_10165
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    AN232_10165
   00280 Valine, leucine and isoleucine degradation
    AN232_10165
   00310 Lysine degradation
    AN232_10165
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    AN232_10165
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:cie01007]
    AN232_10165
Enzymes [BR:cie01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     AN232_10165
    2.6.1.22  (S)-3-amino-2-methylpropionate transaminase
     AN232_10165
    2.6.1.48  5-aminovalerate transaminase
     AN232_10165
Amino acid related enzymes [BR:cie01007]
 Aminotransferase (transaminase)
  Class III
   AN232_10165
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: AWS95553
UniProt: A0A2Z3X355
LinkDB All DBs
Position
complement(2031040..2032323)
Genome map
AA seq 427 aa AA seqDB search
MSTNKELMQRRSNAVPRGVGQIHPIFAERAENCRVWDVEGREFLDFAGGIAVLNTGHLHP
QIVSAVEAQLKKLSHTCFQVLAYEPYLELCEIMNKKVPGDFAKKTLLVTTGSEAVENAVK
IARAATKRTGTIAFSGAYHGRTHYTLSLTGKVNPYSAGMGLMPGHVYRALFPCPLHGISE
DDAIASIHRIFKNDAAPEDVAAIVIEPVQGEGGFYAVTPAFMQRLRAICDEHGIMLIADE
VQSGAGRTGTLFAMEQMGVAPDLTTFAKSIAGGFPLAGVTGRADVMDAIPPGGLGGTYAG
NPIACAAALAVLNIFEQENLLQKANELGQTLREGLLAIAETHREIGDVRGLGAMIAIELF
EDGDHTKPDAKLTAEVVARARDKGLILLSCGPYYNVLRILVPLTIEDAQIRQGLDIIAQC
FAEAKQG
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
atgagcaccaacaaagaactcatgcaacgtcgcagcaacgccgttccccgtggcgtagga
cagatccaccctatttttgccgagcgggcagaaaactgccgggtctgggacgttgaaggc
cgcgaattcctcgattttgctggcggtattgcggtgctgaataccggtcacctgcacccg
cagattgtctctgcggtagaagcgcagttgaaaaaactgtcgcatacctgcttccaggtg
ctggcctatgagccctacctggagctgtgcgaaatcatgaacaagaaagtgccgggcgat
ttcgccaagaaaaccctgctggtgaccaccggttctgaagccgtggaaaacgcggtgaaa
attgcccgcgccgccaccaaacgtacaggtacgatcgccttcagcggcgcttatcatggc
cgtacccactacaccctgtcgctgaccgggaaagtcaacccgtactccgccggaatgggg
ctgatgccgggccatgtttatcgcgcactttttccttgcccgctgcatggcatcagtgaa
gatgatgctatcgccagtattcaccgcatcttcaaaaatgatgccgcgccggaagacgtt
gccgccatcgtcattgaacccgtccagggcgaaggcggtttttacgcggtcaccccggca
tttatgcagcgtctgcgcgccatttgtgacgaacacgggatcatgctgattgccgatgaa
gtgcagagcggcgcgggccgcaccggtacgctgttcgccatggagcagatgggcgttgcg
cccgatcttaccaccttcgccaaatctatcgctggcggcttcccgctggcaggggtaacc
ggtcgcgccgacgtcatggacgctatcccgccggggggccttggcggtacctatgccggt
aacccgattgcctgtgccgccgcgctggcggtgctgaacattttcgagcaggaaaatctg
ctgcaaaaggccaacgaactggggcaaaccctgcgcgaaggcctgctggctatcgccgaa
acgcatcgcgaaattggcgacgtgcgtgggctgggggcgatgatcgccatcgaactgttc
gaagacggcgaccatacgaaaccagacgccaagctgaccgcagaagtggtggcgcgcgcg
cgtgataaagggctgatcctgctctcctgcgggccttactacaacgtgctgcgcatcctt
gtcccgctgaccattgaagatgcgcaaatccgccaggggctggacatcatcgcccagtgt
tttgctgaggcgaagcagggctaa

DBGET integrated database retrieval system