KEGG   Citrobacter sp. CRE-46: AN232_14595Help
Entry
AN232_14595       CDS       T05520                                 

Definition
(GenBank) alpha-amylase
  KO
K01176  alpha-amylase [EC:3.2.1.1]
Organism
cie  Citrobacter sp. CRE-46
Pathway
cie00500  Starch and sucrose metabolism
cie01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cie00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    AN232_14595
Enzymes [BR:cie01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     AN232_14595
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase Glyco_hydro_70 Alpha-amylase_C DUF1939 Malt_amylase_C
Motif
Other DBs
NCBI-ProteinID: AWS96350
UniProt: A0A2Z3X6E7
LinkDB All DBs
Position
complement(3003545..3005032)
Genome map
AA seq 495 aa AA seqDB search
MKNPTLLQYFHWYYPDGGQLWPELAERAGGLNDIGINMVWLPPAYKGASGGYSVGYDSYD
LFDLGEFDQRGTIPTKYGDKNQLLAAIDALKHNDIAVLLDVVVNHKMGADEKESIRVQRV
NADDRTQIDDEIIECEAWTRYTFPARAGQYSQFIWDYKCFSGIDHIENPTEDGIFKIVND
YTGEGWNDQVDDELGNFDYLMGENIDFRNHAVTEEIKYWARWVMEQTQCDGFRLDAVKHI
PAWFYKEWIEHVQEVAPKPLFIVAEYWSHEVDKLQTYINQVEGKTMLFDAPLQMKFHEAS
RQGRDYDMSQIFTDTLVEADPFHAVTLVANHDTQPLQALEAPVESWFKPLAYALILLREN
GVPSVFYPDLYGAHYEDTGGDGETYPIDMPIIEQLPELILARQRFAHGVQTLFFDHPNCI
AFSRSGTDEDPGCVVVLSNGDDGEKTINLGANYGNKTWRDYLGNREESVVTDENGEATFF
CNGGSVSVWVIEDVL
NT seq 1488 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaatcccacgttattgcagtattttcactggtattaccccgatgggggtcaactc
tggcccgagcttgccgaacgcgcaggcggactcaatgatatcggcatcaatatggtatgg
ctgccccccgcctataaaggcgcatcaggcggttattccgttggctacgactcgtacgat
ctgtttgacctcggcgagtttgaccagaggggaaccatccccaccaaatatggcgataaa
aaccagctgctggcggcaattgacgcgctgaaacacaacgacatcgccgtactgctcgac
gtggtggttaaccacaaaatgggcgcggatgaaaaagagagtattcgtgtccagcgggtt
aacgccgacgatcgcacgcaaatagacgatgaaatcatcgaatgtgaggcctggacgcgc
tataccttccccgcccgcgcaggccagtattcacaattcatttgggactataaatgcttc
agcggcattgaccatatcgagaaccccaccgaagacggcattttcaaaatcgttaacgat
tacaccggtgaaggctggaacgatcaggttgatgatgaactgggtaattttgattatctg
atgggcgagaacatcgattttcgaaatcacgccgtgaccgaggagatcaaatactgggcg
cgctgggtgatggagcaaacccagtgtgacggttttcgtttagatgcggtgaaacatatt
ccggcatggttttataaagagtggattgaacacgtacaggaggtcgcgcccaagccattg
tttattgtcgcggaatactggtcccacgaagtcgacaaactgcaaacctacattaaccag
gtggaggggaaaaccatgctgttcgacgcccctttgcagatgaaattccacgaagcctcc
cgtcagggccgcgattacgacatgagccaaatcttcacggacacattagtcgaggccgat
ccgtttcatgccgtcacgctggttgccaatcacgatacccagccgttgcaggcgctggaa
gcccctgtcgagtcatggtttaagccgctggcctatgcgttgatcctgctacgggaaaac
ggtgtaccgtcggtgttttatcctgacctctacggggcgcattacgaagacaccggcggc
gatggcgaaacgtatcctatcgacatgccgatcatcgaacagctccccgaactgatcctc
gcgcgccagcgcttcgcccacggcgtacagacgctctttttcgatcatcctaactgtatc
gcttttagccgcagcggaacggacgaagatcccggctgcgtggtggtgctgtctaacggt
gacgatggggaaaagaccatcaatctcggcgcgaattacggtaataaaacctggcgtgat
tatctgggaaatcgcgaagaaagcgtggtcaccgatgaaaacggggaagcgacgtttttc
tgcaacggcggtagcgtcagcgtgtgggtgattgaagacgtgttgtaa

DBGET integrated database retrieval system