KEGG   Citrobacter sp. CRE-46: AN232_18680Help
Entry
AN232_18680       CDS       T05520                                 

Definition
(GenBank) superoxide dismutase [Fe]
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
cie  Citrobacter sp. CRE-46
Brite
Enzymes [BR:cie01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     AN232_18680
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-ProteinID: AWS97093
UniProt: A0A2Z3X7S0
LinkDB All DBs
Position
3755520..3756101
Genome map
AA seq 193 aa AA seqDB search
MSFELPALPYAKDALAPHISAETLEYHYGKHHQTYVTNLNNLIKGTAFEGKSLEEIVRSS
EGGVFNNAAQVWNHTFYWNCLAPNAGGEPTGKLADAIAASFGSFADFKAQFTDAAIKNFG
SGWTWLVKGTDGKLAIVSTSNAGTPLTTDATPLMTVDVWEHAYYIDYRNARPGYLEHFWA
LVNWEFVAKNFAA
NT seq 582 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtttgaattacctgcattaccgtatgccaaagatgctctggcaccgcacatttct
gccgaaacgctggaataccactatggcaaacaccatcaaacctacgtgaccaacctgaac
aacctgatcaaaggcacggcgtttgaaggtaaatcactggaagagatcgttcgtagctct
gaaggcggtgtattcaataatgctgcacaggtatggaaccacacgttctactggaactgc
ctggcgccgaacgcaggtggcgagccgaccggtaaactggccgatgcaattgccgcctcc
tttggcagctttgcggatttcaaagcgcaattcaccgatgccgctatcaaaaacttcggt
tctggctggacctggctggttaaaggaacggatggcaaactggctatcgtttctacttcc
aacgcaggtactccgctgacgaccgacgcgacgccgctgatgaccgttgacgtatgggaa
cacgcctactacatcgattatcgcaatgcccgtcctggctacctggagcacttctgggcg
ctggtgaactgggaatttgttgcgaagaacttcgcagcataa

DBGET integrated database retrieval system