KEGG   Citrobacter sp. CRE-46: AN232_23165Help
Entry
AN232_23165       CDS       T05520                                 

Definition
(GenBank) serine-type D-Ala-D-Ala carboxypeptidase
  KO
K07258  serine-type D-Ala-D-Ala carboxypeptidase (penicillin-binding protein 5/6) [EC:3.4.16.4]
Organism
cie  Citrobacter sp. CRE-46
Pathway
cie00550  Peptidoglycan biosynthesis
cie01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cie00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    AN232_23165
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:cie01002]
    AN232_23165
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:cie01011]
    AN232_23165
Enzymes [BR:cie01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     AN232_23165
Peptidases [BR:cie01002]
 Serine Peptidases
  Family S11: D-Ala-D-Ala carboxypeptidase A family
   AN232_23165
Peptidoglycan biosynthesis and degradation proteins [BR:cie01011]
 Peptidoglycan biosynthesis and degradation
  DD-Carboxypeptidase/DD-Endopeptidase (Low molecular weight PBP)
   AN232_23165
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_S11 PBP5_C Beta-lactamase2 Beta-lactamase
Motif
Other DBs
NCBI-ProteinID: AWS97891
UniProt: A0A2Z3XBI3
LinkDB All DBs
Position
4595651..4596862
Genome map
AA seq 403 aa AA seqDB search
MKTTFSARFVQRMALTAALCAATLSAAHADDLNIKTMIPGVPQIDAESYILIDYNSGKVL
AEQNADTRRDPASLTKMMTSYVIGQAMKAGKFKETDLVTVGNDAWATGNPVFKGSSLMFL
KPGMQVPVSQLIRGINLQSGNDACVAMADFAAGSQDAFVGLMNSYVNALGLKNTHFQTVH
GLDADGQYSSARDMAMIGQALIRDVPNEYSIYKEKEFTFNGIRQLNRNGLLWDNSLNVDG
IKTGHTDKAGYNLVASATEGQMRLISAVMGGRTYKGRETESKKLLTWGFRFFETVNPLKV
GKEFASEPAWFGNTDRASLGVDKDVYLTIPRGRMKDLKASYVLNTTELHAPLQKNQVVGT
INFQLDGKTIEQRPLVVLQEIPEGNFFGKIIDYIKLMFHHWFG
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
atgaagaccactttttccgctcgtttcgtgcagcgtatggcgctcaccgcggctctctgc
gcagctactctctctgctgcccatgccgatgacctgaatattaaaaccatgatccccggc
gttccgcagatcgatgcggagtcgtatatcctgattgattacaactcaggtaaagttctg
gcagaacagaatgctgacactcgccgcgaccccgccagcctgaccaagatgatgaccagc
tacgtcatcggccaggcgatgaaagccgggaagttcaaagaaaccgatctggtcaccgtt
ggcaatgacgcatgggctacgggtaacccggtctttaaaggttcatcgctgatgttcctc
aagccaggcatgcaggttcctgtctctcagttgatccgtggtattaacctgcagtccggg
aacgacgcatgtgtggcgatggctgacttcgctgccggcagccaggatgctttcgtcggc
ctgatgaacagctatgtgaacgcgctgggtctgaaaaacacccacttccagaccgttcat
ggtcttgatgctgacggtcagtacagttcagcccgcgatatggcgatgattggtcaggcg
ctgattcgcgatgtacctaatgaatactctatctataaagaaaaagagttcacctttaac
ggcattcgtcagttaaaccgtaacggtctgctgtgggataacagcctgaatgtcgacggt
atcaaaaccggtcacaccgataaagctggctataaccttgttgcatccgcaaccgaaggc
cagatgcgtctgatctccgccgtaatgggtggccgcacctataaaggtcgcgaaaccgaa
agcaaaaaactgctgacctggggcttccgtttcttcgaaaccgtcaacccgctgaaagtg
ggtaaagaatttgcctcagaacccgcctggtttggtaacaccgatcgcgcatcgttaggt
gtcgataaggatgtctacctgaccattccgcgcggccgtatgaaagatctgaaagcaagt
tatgtgctgaacaccactgaactgcacgcgccgctgcagaaaaaccaggttgtcggtacc
atcaacttccagcttgatggcaaaaccatcgagcagcgcccgctggtcgtgctgcaggaa
atcccggaaggcaacttctttgggaaaatcattgattacattaaattaatgttccatcac
tggtttggctaa

DBGET integrated database retrieval system