KEGG   Citrobacter sp. CRE-46: AN232_23285Help
Entry
AN232_23285       CDS       T05520                                 

Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
cie  Citrobacter sp. CRE-46
Brite
KEGG Orthology (KO) [BR:cie00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    AN232_23285
Enzymes [BR:cie01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     AN232_23285
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 HI0933_like FAD_binding_2 NAD_binding_8 FAD_oxidored Thi4 FAD_binding_3 K_oxygenase AlaDh_PNT_C Glutaredoxin FMO-like DAO
Motif
Other DBs
NCBI-ProteinID: AWS97915
UniProt: A0A2Z3XB29
LinkDB All DBs
Position
complement(4617203..4618768)
Genome map
AA seq 521 aa AA seqDB search
MLDTNMKTQLRAYLEKLTKPVELIATLDDSAKSAEIKELLTEIAELSEKVTFTEDNTLAV
RKPSFLITNPGSHQGPRFAGSPLGHEFTSLVLALLWTGGHPSKEAQALLEQIRDLDGDFE
FETYYSLSCHNCPDVVQALNLMSVLNPRIKHTAIDGGTFQNEITDRNVMGVPAVFMNGKE
FGQGRMTLTEIVAKVDTGAEKRAAEELNKRDAYDVLIVGSGPAGAAAAVYSARKGIRTGL
MGERFGGQVLDTVDIENYISVPKTEGQKLAGALKAHVDDYDVDVIDSQSASKLVPAAQEG
GLHQIETASGAVLKARSIIIATGAKWRNMNVPGEDQYRTKGVTYCPHCDGPLFKGKRVAV
IGGGNSGVEAAIDLAGIVEHVTLLEFAPEMKADQVLQNKLRSLKNVDIILNAQTTEVKGD
GSKVTGLEYRDRVSGDVHSVELAGIFVQIGLLPNTNWLEGAVERNRMGEIIIDAKCETSV
KGVFAAGDCTTVPYKQIIIATGEGAKASLSSFDYLIRTTVA
NT seq 1566 nt NT seq  +upstreamnt  +downstreamnt
atgctcgacacaaatatgaaaacccagctcagggcttaccttgagaaactgaccaaacct
gttgagctgattgctacgctggatgacagcgctaaatcggcagaaataaaggaactgctg
actgaaattgctgaactgtcagaaaaagtcaccttcacagaagacaatactctggcagtg
cgtaagccatcgttcctgattaccaatcctggctctcaccaggggccgcgctttgcgggt
tctccgctgggccatgaatttacctcgctggtgctcgcgctgttgtggacaggtggtcat
ccgtcaaaagaggcgcaggcgttgctggagcagatccgcgatctcgacggtgattttgaa
tttgaaacctattattcactctcctgccataactgtccggacgtggtgcaggcgctgaac
ctgatgtcggtactgaacccacgcattaaacatacggcgattgacggcggtacgttccag
aatgaaatcaccgatcgtaacgtgatgggcgttccggcggtatttatgaacggtaaagag
ttcggccagggtcgcatgacgctgactgagatcgtggcgaaggtggacaccggcgcagag
aaacgtgcggctgaagagttgaacaagcgtgatgcttatgacgtactgattgttggttct
ggccctgcgggagcggctgcggcggtgtactctgcacgtaaaggtatccgcaccggtctg
atgggcgaacgttttggcggtcaggttctggataccgttgatattgaaaactatatctcg
gtaccgaaaaccgaaggccagaaactggctggcgcgctgaaagcacacgttgatgactat
gatgttgatgtgatcgacagccaaagtgccagcaaactggttcctgcggcgcaggagggt
gggctgcatcagattgaaacggcatccggcgcggtgctgaaagcgcgcagcattatcatc
gcgaccggtgcgaaatggcgcaacatgaatgttccgggcgaagatcaatatcgcaccaaa
ggcgtaacttactgtccgcactgtgatggcccactgtttaaaggcaagcgtgtggcggtg
attggcggtggtaactccggtgttgaagccgctatcgatctggcgggcatagtggaacat
gtgacgctgctggagtttgctcctgaaatgaaggccgatcaggtgctgcagaataaactg
cgtagtctgaaaaacgtcgacatcattttgaatgcgcaaacgacagaagtaaaaggcgat
ggcagcaaagtcactgggctcgagtatcgtgaccgcgtgagcggcgatgttcacagtgta
gaactggcaggtatttttgttcagattggtctgctgccgaacaccaactggctggaaggc
gccgttgaacgtaaccgcatgggtgaaattatcattgatgcgaagtgcgaaaccagcgtg
aaaggtgttttcgctgcaggtgactgcacaaccgtaccctataagcagatcatcatcgcg
acaggcgaaggcgcgaaagcctcgttaagctcctttgattatctgattcgcaccacagta
gcataa

DBGET integrated database retrieval system