KEGG   Citrobacter sp. CRE-46: AN232_24480Help
Entry
AN232_24480       CDS       T05520                                 

Definition
(GenBank) alkaline phosphatase
  KO
K01077  alkaline phosphatase [EC:3.1.3.1]
Organism
cie  Citrobacter sp. CRE-46
Pathway
cie00730  Thiamine metabolism
cie00790  Folate biosynthesis
cie01100  Metabolic pathways
cie02020  Two-component system
Module
cie_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:cie00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    AN232_24480
   00790 Folate biosynthesis
    AN232_24480
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    AN232_24480
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cie04147]
    AN232_24480
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:cie00537]
    AN232_24480
Enzymes [BR:cie01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     AN232_24480
Exosome [BR:cie04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   AN232_24480
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:cie00537]
 Enzymes
  AN232_24480
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alk_phosphatase Metalloenzyme Sulfatase
Motif
Other DBs
NCBI-ProteinID: AWS98138
UniProt: A0A2Z3XB86
LinkDB All DBs
Position
complement(4872092..4873507)
Genome map
AA seq 471 aa AA seqDB search
MKQSALAIALLPLLFTPIINAETSTVAVMDNRAAQGDITTPGGARRLSADQTAALRESLN
DKPAKNIILLIGDGMGDSEITAARNYAEGAGGFFKGIDALPLTGQYTHYALDKKTGKPDY
VTDSAASATAWTTGVKTYNGALGVDIHEKDHATILEMAKAAGLATGNVSTAELQDATPAA
LVAHVTSRKCYGPDVTREKCPTNALEKGGKGSITEQLLNARADVTLGGGAKTFAETAAAG
EWQGKTLREQALARGYQMVSDAATLAAITEANQDKPLLGLFSDGNMPVRWEGPKASYHGN
LDKPAVTCTPNPKRDDTVPTLAQMTDKAIELLSKNEKGFFLQVEGASIDKQDHAANPCGQ
IGETVDLDEAVQRALAFAKQDGNTLVVVTADHAHASQIVAPDTKAPGLTQALNTKDGAVM
VISYGNSEEESQEHTGSQLRIAAYGPHAANVVGLTDQTDLFYTMKAALGLK
NT seq 1416 nt NT seq  +upstreamnt  +downstreamnt
gtgaaacaaagcgcactcgctattgccctgttacctttgctgtttaccccgattattaat
gcagaaacatctaccgtagcggttatggataatcgtgccgctcagggtgatatcaccacg
ccaggcggcgcccgccgcttgtcagccgatcaaacggcggctttacgcgaatctctgaac
gataaacctgccaaaaatattattttacttattggcgatgggatgggcgattcagaaata
acggcagcgcgaaattatgccgaaggcgcgggcggtttttttaaaggtattgatgcctta
ccgttgaccggacaatacacgcactatgcgttagataagaaaacgggcaagccggattat
gtgacggactcagcggcctcagcgacggcgtggaccaccggggttaaaacttacaatggc
gcgctgggcgttgatatacatgaaaaagatcacgcaacaattttggaaatggcaaaagcg
gcaggtctggccacgggcaacgtttctaccgctgaattgcaggatgcaaccccagcggca
ctggttgctcatgtgacttcacgtaagtgctatggccctgacgtgacccgtgaaaaatgc
ccaaccaatgcgctggaaaaaggcggcaaagggtcaattacagaacaattgctgaatgcc
cgggctgacgtcacgttgggcggtggggcaaaaacgtttgccgaaaccgctgcggcaggg
gagtggcagggcaaaacgttgcgtgaacaagccctggcgcgcggttatcagatggtaagt
gatgccgcgacgctggctgcgattaccgaagctaaccaggataagccgttgctgggcctg
ttctccgacggcaacatgccggtacgctgggaaggtccgaaagcgtcctatcatgggaat
ctggataaaccagcggtgacctgtacgccaaatccaaagcgtgatgacaccgtaccgacg
ctggcgcagatgacggataaagcgattgaactgttaagcaaaaatgagaaaggtttcttc
ctgcaagttgaaggggcatccatcgataaacaggatcacgctgccaatccgtgcggacag
attggtgaaacggttgatctggacgaagcggtacagcgcgcgcttgcctttgcgaagcaa
gacggcaacaccctggtggtggtaaccgctgaccacgcgcatgccagccagattgtcgca
cctgataccaaagcgcctggtctgactcaggcactgaacaccaaagatggcgcggtgatg
gtcatcagctacggcaattctgaagaggaatctcaggagcacaccggtagccaactgcgc
atcgccgcttatggcccgcatgcggcgaatgtggtcggtctgaccgatcaaactgatctg
ttttacaccatgaaagcggcgttagggctgaagtaa

DBGET integrated database retrieval system