KEGG   Citrobacter sp. CRE-46: AN232_24495Help
Entry
AN232_24495       CDS       T05520                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
cie  Citrobacter sp. CRE-46
Pathway
cie00473  D-Alanine metabolism
cie00550  Peptidoglycan biosynthesis
cie01100  Metabolic pathways
cie01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:cie00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    AN232_24495
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    AN232_24495
 09160 Human Diseases
  09175 Drug resistance: Antimicrobial
   01502 Vancomycin resistance
    AN232_24495
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:cie01011]
    AN232_24495
Enzymes [BR:cie01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     AN232_24495
Peptidoglycan biosynthesis and degradation proteins [BR:cie01011]
 Precursor biosynthesis
  Amino acid ligase
   AN232_24495
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp CPSase_L_D2 ATPgrasp_ST ATP-grasp_3 ATP-grasp_4 RimK GARS_A
Motif
Other DBs
NCBI-ProteinID: AWS98677
UniProt: A0A2Z3XF65
LinkDB All DBs
Position
4875600..4876694
Genome map
AA seq 364 aa AA seqDB search
MAKLRVGIVFGGKSAEHEVSLQSAKNIVDAIDKTRFDVVLLGIDKQGQWHVSDASNYLLN
SDDPAHIALRPSATSLAQVPGKQEHQLIDAQNGQPLPTVDVIFPIVHGTLGEDGSLQGML
RVANLPFVGSDVLGSAACMDKDVTKRLLRDAGLNIAPFITLTRANRNNISFAEVQSRLGL
PLFVKPANQGSSVGVSKVTSEAQYNQAVALAFEFDHKVVVEQGIKGREIECAVLGNDHPQ
ASTCGEIVLNSDFYAYDTKYIDDNGAKVVVPAAIAPEINDKIRQIAIQAYQTLGCAGMAR
VDVFLTADNDVVINEINTLPGFTNISMYPKLWQASGLGYTDLITRLIELALERHAADSAL
KTSM
NT seq 1095 nt NT seq  +upstreamnt  +downstreamnt
atggcaaagttgcgggtaggaatcgtatttggtggtaaatcagcggaacatgaagtgtca
ttgcaatcggcaaaaaatattgtcgatgccatcgacaagactcgctttgacgttgtgctg
ttaggtattgataaacaagggcaatggcacgttagcgatgccagtaactatctgctcaat
tcagacgatccggcgcacattgcgctgcgtccttccgcgaccagcctggctcaggttccg
ggtaaacaagagcaccagttgatcgatgcgcaaaacggtcagccgctgccgacggtcgat
gttattttcccgatcgtccacggtacgctgggtgaagatggctctttgcagggtatgctg
cgcgtagcgaatctgccgttcgtcggttctgatgtcctgggttccgcagcctgtatggat
aaagacgtaaccaaacgtctgctgcgcgatgccggattaaatatcgcgccatttattaca
ctcactcgcgcgaaccgcaacaatattagctttgctgaggtgcaatcccgcctgggtctg
ccgttgttcgtgaaacccgccaaccagggatcgtccgttggcgttagcaaagtgaccagt
gaagcacaatacaaccaggctgtcgcgctggcatttgagttcgatcataaagtcgtggta
gagcaagggatcaaaggccgtgagatcgaatgcgcggtactgggcaacgatcatccgcag
gccagcacctgtggtgagatcgtgctgaacagtgatttttacgcatacgataccaaatac
attgacgataatggcgccaaagtagttgttccggcagcgatcgcgccagagattaacgac
aagatccgccagatcgccattcaggcgtaccagacactgggatgtgccggcatggcgcgt
gtagatgtattcttaaccgcagacaacgacgttgtgatcaatgagatcaacaccctgccg
ggcttcaccaacatcagtatgtatccaaaactgtggcaggcgagcggcttaggctatacc
gatttgatcacgcgtctgatcgaactggcgctggagcgccacgctgcggatagcgcgctg
aaaaccagtatgtaa

DBGET integrated database retrieval system