KEGG   Citrobacter sp. FDAARGOS_156: AL515_02410Help
Entry
AL515_02410       CDS       T04313                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
cif  Citrobacter sp. FDAARGOS_156
Pathway
cif00620  Pyruvate metabolism
cif00680  Methane metabolism
cif01100  Metabolic pathways
cif01120  Microbial metabolism in diverse environments
cif01200  Carbon metabolism
Module
cif_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:cif00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    AL515_02410
  Energy metabolism
   00680 Methane metabolism
    AL515_02410
Enzymes [BR:cif01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     AL515_02410
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-ProteinID: AMH12776
LinkDB All DBs
Position
complement(516681..519332)
Genome map
AA seq 883 aa AA seqDB search
MNEQYSALRSNVSMLGKVLGETIKDALGENILDRVETIRKLSKSSRAGNEVNRQELLTTL
QNLSNDELLPVARAFSQFLNLANTAEQYHSISPKGEAASNPEVIARTLRKLKDQPNLDET
TIKKAVESLSLELVLTAHPTEITRRTLIHKMGEVNACLKQLDNKDIVDYERHQLMRRLRQ
LIAQSWHTDEIRKLRPSPVDEAKWGFAVVENSLWEGVPNYLRELNEQLEEHLGYKLPVDF
VPVRFTSWMGGDRDGNPNVTADITRHVLLLSRWKATDLFLKDIQFLISELSMVEATPELM
ALVGEEGAAEPYRYLMKMLRSRLMATQAWLEARLKGEKLPKPVGLLTQNEQLWEPLYACY
QSLQACGMGIIANGELLDTLRRVKCFGVPLVRIDIRQESTRHTEALGELTRYLGIGDYEN
WSEADKQAFLIRELNSKRPLLPRHWEPSNDTREVLDTCRVIAEAPYGSIAAYVISMAKTP
SDVLAVHLLLKESGIGFAMPVAPLFETLDDLNNADDVMSQLLNIDWYRGFIQGKQMVMIG
YSDSAKDAGVMAASWAQYQAQDALIKTCEKAGIELTLFHGRGGSIGRGGAPAHAALLSQP
PGSLKGGLRVTEQGEMIRFKYGLPEVTISSLSLYTAAILEANLLPPPEPKDNWRHIMDEL
SDISCDLYRGYVRENKDFVPYFRSATPEQELGKLPLGSRPAKRRPTGGVESLRAIPWIFA
WTQNRLMLPAWLGAGTALQKVVEDGKQSELEAMCRDWPFFSTRLGMLEMVFSKADLWLAE
YYDQRLVKKELWPLGEELRQRLEADINVVLAIANDSHLMADLPWIAESIQLRNIYTDPLN
VLQAELLYRSRQAEEQGHAPDPRVEQALMVTIAGVAAGMRNTG
NT seq 2652 nt NT seq  +upstreamnt  +downstreamnt
atgaacgaacaatattccgcgttgcgtagtaatgtcagtatgctcggcaaagtgctggga
gagaccatcaaggacgcgctgggagagaacattctcgaccgcgtagaaacaatccgtaag
ttgtccaagtcatcccgcgctggcaatgaagttaatcgccaggaactgctcaccacactg
caaaatctgtctaacgacgagctgctgcccgttgcccgcgcatttagccagttcctgaat
ctggccaataccgccgagcagtaccatagtatttcgccaaaaggcgaagctgccagcaac
ccggaagtgattgctcgcaccctgcgtaaattgaaagaccagcccaacctcgatgaaacc
accatcaagaaagccgtggaatcgctgtctctggagctggtgttgaccgcgcacccaacc
gaaatcacccgccgcaccttgattcataaaatgggtgaagtaaacgcatgcctcaaacag
cttgataataaagacatcgtcgattacgagcgccaccagctgatgcgtcgtctgcgtcag
ttgattgctcagtcctggcatacggatgaaatccgtaaactacgaccaagcccggttgat
gaagccaaatggggcttcgcagtggttgaaaacagcctgtgggaaggcgtacccaactac
ctgcgcgagctaaatgaacagctggaagaacatctgggctataagctacctgtcgatttt
gttccggtacgttttacctcctggatgggcggcgaccgtgatggtaacccgaatgtcacc
gcagatatcacccgccatgtgctgctgcttagccgttggaaagccactgacctgttcctg
aaagacatccagtttttgatttctgaactgtcgatggttgaagccactccggaactgatg
gcgctggtcggtgaagaaggtgcggcagaaccttatcgctatctgatgaaaatgctgcgt
tcacgtctgatggcaactcaggcctggctggaagcgcgtctgaaaggcgaaaaactgcca
aaacctgttggcctgctaacccaaaacgaacagctttgggagccgctatacgcgtgttac
cagtctctacaggcctgtggtatgggcatcatcgccaatggcgagttgctcgacaccctt
aggcgcgtgaaatgttttggcgtaccgctggtacgcattgatattcgtcaggaaagcact
cgtcataccgaagcactgggcgaactgacccgctatctgggaattggcgactacgaaaac
tggtcagaagcggataaacaagcgttcctgatccgcgagctgaattccaagcgtccgctg
ctgccgcgtcactgggaaccgagcaacgatacccgtgaagtgctcgatacctgccgggtg
attgccgaagcgccttatggctccattgctgcctatgttatctcaatggcgaaaacaccg
tctgacgtactggcggtgcatttactgctgaaagaatccggcattggttttgctatgcct
gttgccccgctgtttgagacgctggacgacctgaacaacgccgatgatgtcatgagccag
ctactgaatatcgactggtatcgcggctttattcagggcaaacagatggtcatgattggc
tactctgactccgcaaaagatgcgggcgtgatggcggcctcctgggcgcaataccaggca
caggacgcgctgatcaaaacctgcgaaaaagccggtatcgaactgacgctgttccacggt
cgcggcggctccattggtcgcggcggcgcgcctgcccatgcggcactgctctctcaaccg
ccaggcagcctgaaaggcggcctgcgcgtgacagaacaaggtgagatgatccgctttaag
tacggcctgccggaagtcaccatcagcagcctgtcgctgtacactgccgcaattctggag
gctaacctgttaccgccgccggagccaaaagataactggcgtcatatcatggatgagctt
tcagatatctcctgcgatctctatcgtggatatgttcgtgaaaacaaagactttgtacct
tacttccgttccgcaacaccagagcaggaactgggcaagttaccactcggctcacgtccg
gcaaaacgtcgcccgaccggtggcgtagagtctctgcgtgctattccgtggatcttcgcc
tggacgcagaaccgcctgatgcttccggcctggctgggtgcgggtacggcactgcaaaaa
gtggttgaagacggtaagcaaagcgagcttgaagcaatgtgccgtgactggccattcttc
tccacgcgtcttggcatgctggagatggtgttctcaaaagctgacctgtggctggcggag
tactacgatcagcgcctggtcaaaaaagagctttggccattgggtgaagaactgcgtcag
cgtctggaagccgatatcaatgtggtgttggcaatcgccaatgactcacatttgatggcc
gatctaccatggattgccgagtctattcagttaaggaatatttatactgacccactgaac
gtcttacaggccgaattattatatcgttcgcgccaggcagaagagcaaggtcatgcacca
gacccacgcgtcgaacaagcgctgatggtgacaattgctggcgttgctgccggcatgcgt
aacaccggctaa

DBGET integrated database retrieval system