KEGG   Citrobacter sp. FDAARGOS_156: AL515_10100Help
Entry
AL515_10100       CDS       T04313                                 

Definition
(GenBank) decarboxylating cobalt-precorrin-6B (C(15))-methyltransferase
  KO
K02191  cobalt-precorrin-6B (C15)-methyltransferase [EC:2.1.1.196]
Organism
cif  Citrobacter sp. FDAARGOS_156
Pathway
cif00860  Porphyrin and chlorophyll metabolism
cif01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cif00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    AL515_10100
Enzymes [BR:cif01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.196  cobalt-precorrin-6B (C15)-methyltransferase [decarboxylating]
     AL515_10100
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MTS Methyltransf_31 Cons_hypoth95 Methyltransf_12 PCMT Methyltransf_25 PrmA GidB Met_10 CMAS Methyltransf_18 Methyltransf_2 Methyltransf_4 Methyltransf_11 Methyltransf_23 RrnaAD DOT1 Methyltransf_16
Motif
Other DBs
NCBI-ProteinID: AMH14190
LinkDB All DBs
Position
2195478..2196047
Genome map
AA seq 189 aa AA seqDB search
MKDELFLRGEKVPMTKEAVRALALSKLELHRASHLIDIGAGTGSVSIEAALQYPGLRVTA
IERNPDALRLLDENRQHFACANIDIFPGIAPMTIAEKADAIFMGGSGGHLTELIDWSMRQ
LHPAGRLVMTFILQENLNTALAHLDRPGVQGVDCLQLQVSSLTTLGSGHYFKPNNPVFVI
ACQKEGTHV
NT seq 570 nt NT seq  +upstreamnt  +downstreamnt
atgaaagatgagctttttctacgtggagagaaagtgccgatgaccaaagaagcggtacgc
gcacttgccctctcaaaacttgaattacaccgcgccagtcacctgattgatattggtgcc
ggaaccggcagcgtgtcgatagaagccgcgctgcaatacccaggattacgcgtgacggca
attgagcgtaatccggatgcgctcaggctgctggacgaaaaccgtcagcattttgcctgc
gcaaatatcgacatttttccaggtatcgcgccgatgactatcgcggaaaaagccgatgcc
atttttatgggcggcagcggcggccatctgaccgaactgattgactggtcaatgcgtcaa
ttgcatcccgcagggcggttggtgatgacatttatccttcaggaaaacctcaacaccgcg
ctggctcatctggaccgtcctggcgtacagggtgtggattgcctgcaactgcaggtttcc
tcacttaccacgctgggtagtggtcactatttcaaaccgaataaccccgtatttgttatc
gcctgtcagaaggaaggaacccatgtctga

DBGET integrated database retrieval system