KEGG   Citrobacter sp. FDAARGOS_156: AL515_11505Help
Entry
AL515_11505       CDS       T04313                                 

Definition
(GenBank) superoxide dismutase [Fe]
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
cif  Citrobacter sp. FDAARGOS_156
Brite
Enzymes [BR:cif01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     AL515_11505
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-ProteinID: AMH14445
LinkDB All DBs
Position
complement(2484938..2485519)
Genome map
AA seq 193 aa AA seqDB search
MSFELPALPYAKDALAPHISAETLEYHYGKHHQTYVTNLNNLIKGTAFEGKSLEEIVRSS
EGGVFNNAAQVWNHTFYWNCLAPNAGGEPTGKLAEAIAASFGSFADFKAQFTDAAIKNFG
SGWTWLVKGTDGKLAIVSTSNAGTPLTTDATPLMTVDVWEHAYYIDYRNARPGYLEHFWA
LVNWEFVAKNFAA
NT seq 582 nt NT seq  +upstreamnt  +downstreamnt
atgtcgttcgaattacctgcattaccgtatgccaaagatgctctggcaccgcacatttct
gccgaaacgctggaataccactatggcaaacatcaccagacttacgttactaacctgaat
aacctgattaaaggcacggcgtttgaaggtaaatcactggaagagatcgtacgtagctct
gaaggtggtgtattcaataacgcagcccaggtctggaaccacacgttctactggaactgc
ctggccccgaacgcaggtggcgagccgaccggtaaactggccgaagcgattgccgcctcc
tttggcagctttgcagacttcaaagcacaattcaccgatgccgctatcaagaatttcggt
tctggctggacctggctggtcaaaggaacggatggcaaactggctatcgtgtccacctcc
aacgcaggtacaccgctgacgactgacgcgacgccgctgatgaccgttgacgtgtgggaa
catgcttactacatcgattatcgtaatgcccgtcctggctacctggaacacttctgggca
ctggtgaactgggaatttgttgcgaaaaacttcgcagcataa

DBGET integrated database retrieval system