KEGG   Citrobacter sp. FDAARGOS_156: AL515_11715
Entry
AL515_11715       CDS       T04313                                 

Definition
(GenBank) two-component system sensor histidine kinase RstB
  KO
K07639  two-component system, OmpR family, sensor histidine kinase RstB [EC:2.7.13.3]
Organism
cif  Citrobacter sp. FDAARGOS_156
Pathway
cif02020  Two-component system
Brite
KEGG Orthology (KO) [BR:cif00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    AL515_11715
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:cif01001]
    AL515_11715
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:cif02022]
    AL515_11715
Enzymes [BR:cif01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.13  Protein-histidine kinases
    2.7.13.3  histidine kinase
     AL515_11715
Protein kinases [BR:cif01001]
 Histidine kinases
  OmpR family
   AL515_11715
Two-component system [BR:cif02022]
 OmpR family
  RstB-RstA
   AL515_11715
SSDB
Motif
Pfam: HATPase_c HAMP HisKA HATPase_c_2 HATPase_c_3
Other DBs
NCBI-ProteinID: AMH14484
LinkDB
Position
complement(2525319..2526620)
AA seq 433 aa
MKKLFVQFYLLLFVCFLVMTLLVGLVYKFTAERAGRQSLDDLMKSSLYLMRSELREIPPR
DWGKTLKEMDLNLSFDLRVEPLNKYHLDAPTMQRLREGDIVALDDQYTFIQRIPRSHYVL
AVGPVPYLYFLHQMRLLDVALMAFIAISLAFPVLIWMRPHWQEMLRLEAAAQRFGEGHLN
ERLHFDSGSSFERLGVAFNQMADNINALIASKKQLIDGIAHELRTPLVRLRYRLEMSDNL
TEQESQALNRDIGQLEALIEELLTYARLDRPQNELKLSVPDLPMWLTTHLEDVQSVNPDR
AVRLRHLQIGDYGALDMRLMERVLDNLLNNALRYCQSTVQASLQLNGSQATLIVEDDGPG
IAPAAREQIFEPFVRLDPSRDRATGGCGLGLAIVHSIALAMGGTVVCGESELGGARFSFS
WPVWHNIPEFSAA
NT seq 1302 nt   +upstreamnt  +downstreamnt
atgaaaaagctgtttgtgcagttttatctcttattgtttgtctgttttctggtgatgacc
ctgctggttggcctggtgtacaaattcaccgcggaacgtgcgggtagacagtcgctcgac
gacttgatgaaaagctcgttgtatctgatgcgcagcgaattacgcgaaatcccgccgcgt
gactgggggaaaaccctgaaagagatggatttaaatctgtcttttgatcttcgcgtagaa
ccgttgaataaataccatctggatgctcccaccatgcagcgcttacgggaaggcgatatc
gttgcgctcgacgatcagtacacctttattcaacgaattccgcgaagccactatgtacta
gccgtcggcccggtaccttatctctatttcctgcaccagatgcgcttgctggacgtcgcg
ctgatggccttcattgctatttcattagccttccctgtgctgatctggatgcgcccacac
tggcaagagatgctcagactggaggccgctgcgcagcgttttggtgaagggcatcttaat
gagcggttgcactttgacagcggatcaagctttgagcgcctgggcgtggcgtttaaccaa
atggcagacaatatcaatgccctgattgccagtaaaaaacagctgattgacggcattgcc
catgagcttcgcacaccgctggtgcgattgcgttaccgcctggaaatgagcgataacctc
accgagcaggaatcgcaggcgctaaaccgcgatattggtcaactggaagcgttaattgaa
gaattgctcacctatgctcgtctggatcggccgcaaaatgagctaaaactcagtgtcccg
gacctgcctatgtggctaacaacacatctggaagatgtacaaagcgtcaatcccgatcgt
gcggtacgcctgcgccatcttcaaatcggagactacggcgcactggatatgcgtttgatg
gagcgtgtgctggataatttgttaaacaacgctctgcgttactgccagtctactgtgcaa
gccagcctgcaactcaatgggagtcaggcaacgcttatcgtcgaagatgatggacccggc
atcgcgccagctgcgcgcgagcaaatttttgaaccgttcgttcgtctggaccccagccgt
gaccgggcgacaggtggctgcggacttggcctcgccatcgtccactccattgctctggct
atgggcggtactgtggtctgtggtgaaagtgaactcggtggtgcccgcttctccttcagt
tggcctgtctggcataacatacctgaattttcagctgcctga

DBGET integrated database retrieval system