KEGG   Citrobacter sp. FDAARGOS_156: AL515_12575Help
Entry
AL515_12575       CDS       T04313                                 

Definition
(GenBank) alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
cif  Citrobacter sp. FDAARGOS_156
Pathway
cif00473  D-Alanine metabolism
cif01100  Metabolic pathways
cif01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:cif00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    AL515_12575
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    AL515_12575
Enzymes [BR:cif01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     AL515_12575
Peptidoglycan biosynthesis and degradation proteins [BR:cif01011]
 Precursor biosynthesis
  Racemase
   AL515_12575
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C
Motif
Other DBs
NCBI-ProteinID: AMH14641
LinkDB All DBs
Position
2705368..2706594
Genome map
AA seq 408 aa AA seqDB search
MAAPLGRLALIPLLLITACHQPIPTTQAGSVPFAVNKQPVVDNTTLEISRSALEYNIHKV
QQLLGDKTRMCAILKGDAYGHDLSLVTPVMMQNGVQCIGIASNEEISIVRQSGYTSQLMR
VRNATEKEMRQAADFDTEELIGNLDMAKRLSAIAQEKGKTIRIHLALNSGGMSRNGLEVS
TAAGLEEARAISTLPGLKIVGIMSHFPEEDAAVVKRDLARFNTQSAQVLKITGLKREDVT
LHVANTFATLTVPESWLDMVRVGGIFYGDTIASTEYKRVMTFKSAIASVNHYPKGNTVGY
DRTYTLKRNSVLANIPTGYADGYRRVFSNVGHVLIHGQRVPVLGKTSMNTVIVDVTDLPQ
VASGDEVVLFGKQGNAQVSAEEVEEISGALFTEMSILWGATNKRVMVD
NT seq 1227 nt NT seq  +upstreamnt  +downstreamnt
atggcagcacctttgggtcgtttagcacttattccgcttttactgattaccgcctgtcac
caacccatccccaccacgcaagcgggttctgtcccctttgccgttaacaaacaaccggtt
gtagataataccacgctggaaatttcccgtagcgcgctggaatataacattcataaggtt
cagcagctgctgggagacaaaacccggatgtgcgccattcttaaaggcgatgcgtatggc
cacgatctctcactggttacgccggtgatgatgcaaaacggtgtgcagtgtattggcatc
gccagcaacgaggagattagcattgttcgtcagtcaggctatacatcgcagctgatgcgc
gttcgcaacgcgacggaaaaagagatgcgccaggcggcggattttgataccgaagagctg
attggcaatctggatatggctaaacgtctgagtgcaattgcccaggagaaagggaaaacg
attcgtattcatctggccctgaactctggcggtatgtcacgaaacggtctggaagtcagc
accgcggcaggtctggaagaggcccgcgccatttccacgttacccggtctgaaaattgtt
ggcatcatgtcacatttcccggaagaagatgcggcggtggttaaacgcgatctggcccgt
ttcaatacgcaatcggcccaggtactcaaaattaccgggcttaagcgcgaagatgtcacc
ctgcatgtcgcgaatacgttcgccaccctgaccgttcctgaatcctggctcgacatggtg
cgtgttggcggtattttttatggcgataccattgccagcaccgaatacaaacgcgtcatg
acgtttaaatccgcaatcgcgtcggtaaaccattaccccaaaggaaataccgtcggctat
gacagaacctatacccttaaacgtaattccgttcttgccaatattccgacgggttatgct
gatggctatcgtcgcgtgttcagtaacgtggggcacgtattgatccacggccagcgggtt
cctgtactgggtaaaacatccatgaataccgtgattgttgatgtgaccgatctaccgcag
gttgcctccggcgatgaagtggtgttattcggtaaacagggaaatgcgcaggtgagcgca
gaagaagtcgaagaaattagcggcgcgctgttcactgaaatgtcgatcctctggggggcg
acaaacaaacgcgtaatggtcgattaa

DBGET integrated database retrieval system