KEGG   Citrobacter sp. FDAARGOS_156: AL515_14440Help
Entry
AL515_14440       CDS       T04313                                 

Definition
(GenBank) alpha-amylase
  KO
K01176  alpha-amylase [EC:3.2.1.1]
Organism
cif  Citrobacter sp. FDAARGOS_156
Pathway
cif00500  Starch and sucrose metabolism
cif01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cif00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    AL515_14440
Enzymes [BR:cif01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     AL515_14440
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase Glyco_hydro_70 Alpha-amylase_C DUF1939 Malt_amylase_C
Motif
Other DBs
NCBI-ProteinID: AMH14986
LinkDB All DBs
Position
3087919..3089406
Genome map
AA seq 495 aa AA seqDB search
MKNPTLLQYFHWYYPDGGQLWSELAARADGLNDIGINMIWLPPAYKGASGGYSVGYDTYD
LFDLGEFDQKGTIATKYGDKNQLLAAIDALKHNDIAVLLDVVVNHKMGADEKEHIQVQRV
NADDRTQIDDEIVECEAWTRYTFPARAGQYSQFIWDYKCFSGIDHIENPTEDGIFKIVND
YTGEGWNVQVDDELGNFDYLMGENIDFRNHAVTEELKYWARWVMDQTHCDGFRLDAVKHI
PAWFYKEWIEHVQEVAPRPLFIVAEYWSHDVDKLQTYINQVEGKTMLFDAPLQMKFHEAS
RQGRDYDMSQIFTDTLVEADPFHAVTLVANHDTQPLQALEAPVEAWFKPLAYALILLREN
GVPSVFYPDLYGAHYEDTGDDGETYPIDMPIIEQLDELILARQRFAHGVQTLFFDHPNCI
AFSRSGTDDDPGCVVVLSNGDDGEKTINLGANYGNKTWRDYLGNREESVVTDENGEATFY
CNSGSVSVWVIEEVI
NT seq 1488 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaccccaccttattgcagtacttccactggtattaccctgatggcggccagctc
tggtcggaactcgccgcacgcgcggacggacttaatgatatcggcatcaatatgatatgg
ctgcctcctgcctataaaggtgcgtccggcggatactccgttggctatgacacctacgat
ctgtttgatttaggcgaattcgaccagaaaggcactattgccaccaaatacggcgataaa
aatcagttactggcggcaatcgacgcgttaaagcacaacgatatcgcggtactgctggat
gtggtggtcaaccacaaaatgggggccgacgagaaagaacacattcaggttcagcgcgta
aacgccgatgaccgcacgcagattgacgatgagattgtcgaatgcgaggcctggacgcgg
tacaccttccctgcccgtgcgggtcagtactctcaattcatttgggactacaaatgcttt
agcggcatcgatcatattgaaaatcccaccgaggacggcatttttaaaattgttaatgat
tataccggcgaaggctggaacgttcaggtcgatgacgaactgggcaactttgactatctg
atgggcgaaaatatcgattttcgcaatcatgccgtgactgaagagctcaaatactgggca
cgctgggtgatggatcaaacccattgcgatggttttcgcctggatgccgtcaaacatatc
ccggcatggttctataaagagtggatcgagcacgtccaggaggtggcacccaggccgctg
tttatcgtcgcggaatactggtcccatgatgtcgataaactgcaaacctatattaaccag
gtcgaggggaaaaccatgctgtttgatgcccctttgcaaatgaagtttcacgaagcgtcc
cgccagggtcgcgattatgacatgagccagattttcaccgatacgctggtggaggccgat
cccttccatgcggtgacgctggttgcgaaccatgacacccagccgttgcaggcgctggaa
gcccccgtcgaggcgtggtttaagccgctggcctacgcgctgatcctgctgcgcgaaaac
ggtgtgccgtcggtgttctaccccgatctttacggggcacattacgaagacactggcgac
gatggcgaaacttatcctatcgacatgcccatcatcgaacagcttgatgaactgatcctc
gcacgtcagcgcttcgctcacggcgtacagacgctctttttcgatcatcctaactgtatc
gcctttagccgcagcggaacggacgacgatcccggctgcgtggttgttctgtctaacggc
gatgacggggagaagaccatcaatctcggcgcgaattacggcaataaaacctggcgtgat
tatctgggaaatcgcgaggaaagcgtggtcaccgatgaaaacggcgaagcaacgttttat
tgtaacagcgggagcgtcagcgtgtgggtcattgaagaagtgatttaa

DBGET integrated database retrieval system