KEGG   Citrobacter sp. FDAARGOS_156: AL515_15700Help
Entry
AL515_15700       CDS       T04313                                 

Definition
(GenBank) anaerobic glycerol-3-phosphate dehydrogenase subunit A
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
cif  Citrobacter sp. FDAARGOS_156
Pathway
cif00564  Glycerophospholipid metabolism
cif01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cif00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    AL515_15700
Enzymes [BR:cif01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     AL515_15700
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO Fer2_BFD FAD_binding_2 FAD_binding_3 FAD_oxidored DAO_C Pyr_redox_2 Thi4 3HCDH_N HI0933_like NAD_binding_8 FtsA Pyr_redox_3 Lycopene_cycl Pyr_redox GIDA
Motif
Other DBs
NCBI-ProteinID: AMH15217
LinkDB All DBs
Position
3364810..3366438
Genome map
AA seq 542 aa AA seqDB search
MKTRDSQTSDVIIIGGGATGAGIARDCALRGLRVILVERHDIATGATGRNHGLLHSGARY
AVTDAESARECISENQILKRIARHCVEPTDGLFITLPEDELSFQATFIRACEDAGIRAEA
IDPQQARIIEPSVTPQLIGAVKVPDGTVDPFRLTAANMLDAREHGAVILTAHEVTGLIRE
GATVCGVNVRNHLTGEMQSLHAPVVVNAAGIWGQRIAEYADLSIRMFPAKGSLLIMDHRI
NQHVINRCRKPSDADILVPGDTISLIGTTSQHIDYDDIDSNRVTAEEVDILLREGEKLAP
IMAKTRILRAYSGVRPLVASDDDPTGRNVSRGIVLFDHATRDGLDGFITITGGKLMTYRL
MAEWATDAVCRKLGNSRPCTTAETALPGSQESTEHTLKRVISLPAPLRGSAVYRHGDRTP
AWLSEGRQHRSLVCECEAVTAGEVQYAVENLTVNSLLDLRRRTRVGMGTCQGELCACRAA
GLLQRFNVTTAAQSITQLSEFLNERWKGVQPIAWGDALRESEFTRWVYQGLCGLEKEHQD
EI
NT seq 1629 nt NT seq  +upstreamnt  +downstreamnt
atgaaaactcgcgactcgcaaacaagtgacgtgattatcattggtggaggagcaacaggt
gcagggatcgcacgcgactgtgccctgcgcggattgcgcgtcatcttagtagaacgccac
gatatcgcgacaggcgcgacgggccgtaaccacggtctgctgcacagcggagcacgttac
gccgttactgacgctgaatctgcccgcgaatgcattagcgaaaaccaaattctgaaacgt
atcgcccgccattgtgttgagccgacggacggtctgtttattacgctgccggaagatgaa
ctctctttccaggcaacctttattcgtgcctgtgaagacgcgggcatccgcgcagaagcg
attgatccacaacaggcgcgtattatcgaaccttcggtaaccccccaactgattggcgca
gtgaaagtaccagacggtaccgttgatcctttccgcttaaccgccgccaacatgctggat
gcacgagagcatggcgcggttatcttaacggcccatgaagtgacggggctgattcgtgaa
ggtgcgacggtgtgcggggtaaacgtacgcaaccatctgacgggcgagatgcaatctctg
catgcgccggtggtcgtgaatgccgccgggatctggggtcagcgcattgcggaatatgcc
gatctgagcatccgtatgttcccggcgaaaggttctctgttgatcatggatcatcgcata
aatcagcatgttatcaaccgctgccgtaagccatctgatgccgatattctggtgcctggc
gataccatttcgctgatcggtacaacctcacaacacattgattacgacgatatcgacagc
aaccgcgtcaccgcagaagaggtggatattctgctgcgtgaaggtgagaagctggcgcca
attatggcgaaaactcgcatcctgcgtgcttactccggtgtgcgtccgctggtggccagc
gacgacgatccgaccggtcgtaacgtcagccgcggtattgtgttattcgatcacgcaacg
cgcgacggactggacggatttatcaccattaccggtggcaaactgatgacctaccgcctg
atggcggaatgggccaccgacgcagtatgccgcaaactgggcaattctcgcccttgtaca
accgcagagacagctctgccaggctcacaggagtcgaccgaacacacgcttaaacgcgtt
atctctttgccagcgccactgcgcggctctgcggtctaccgccatggcgaccgcaccccg
gcgtggcttagcgaaggccgtcagcaccgcagcctggtctgtgaatgtgaagccgtcacc
gcaggtgaagtgcaatatgccgttgaaaatttaaccgtcaacagtttgctcgatttacgt
cgtcgcacccgcgtcgggatggggacgtgtcagggcgaattgtgtgcctgccgcgctgca
ggtttgctacaacgttttaatgtcaccaccgccgcacaatctatcacccagctttctgaa
ttcctcaacgaacgctggaaaggcgtgcagcctatcgcgtggggagatgcgctgcgcgaa
agcgaattcacgcgttgggtctatcagggattgtgcggtctggaaaaggagcaccaggat
gaaatttga

DBGET integrated database retrieval system