KEGG   Citrobacter sp. FDAARGOS_156: AL515_16130Help
Entry
AL515_16130       CDS       T04313                                 

Gene name
fadJ
Definition
(GenBank) fatty acid oxidation complex subunit alpha FadJ
  KO
K01782  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
cif  Citrobacter sp. FDAARGOS_156
Pathway
cif00071  Fatty acid degradation
cif00280  Valine, leucine and isoleucine degradation
cif00281  Geraniol degradation
cif00310  Lysine degradation
cif00362  Benzoate degradation
cif00380  Tryptophan metabolism
cif00410  beta-Alanine metabolism
cif00640  Propanoate metabolism
cif00650  Butanoate metabolism
cif00903  Limonene and pinene degradation
cif00930  Caprolactam degradation
cif01100  Metabolic pathways
cif01110  Biosynthesis of secondary metabolites
cif01120  Microbial metabolism in diverse environments
cif01130  Biosynthesis of antibiotics
cif01200  Carbon metabolism
cif01212  Fatty acid metabolism
Module
cif_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:cif00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    AL515_16130 (fadJ)
   00650 Butanoate metabolism
    AL515_16130 (fadJ)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    AL515_16130 (fadJ)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    AL515_16130 (fadJ)
   00310 Lysine degradation
    AL515_16130 (fadJ)
   00380 Tryptophan metabolism
    AL515_16130 (fadJ)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    AL515_16130 (fadJ)
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    AL515_16130 (fadJ)
   00281 Geraniol degradation
    AL515_16130 (fadJ)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    AL515_16130 (fadJ)
   00930 Caprolactam degradation
    AL515_16130 (fadJ)
Enzymes [BR:cif01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     AL515_16130 (fadJ)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     AL515_16130 (fadJ)
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     AL515_16130 (fadJ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2
Motif
Other DBs
NCBI-ProteinID: AVH82035
LinkDB All DBs
Position
complement(3452468..3454615)
Genome map
AA seq 715 aa AA seqDB search
MEMTSAFTLNVRLDNVAVVSIDVPGEKMNTLKAEFASQVRAILKQIRDNKALRGVVFISA
KPDNFIAGADINMIGSCRSAQEAETLARQGQQIMAEINALPIPVVAAIHGACLGGGLEMA
LACHNRICTDDAKTVLGLPEVQLGLLPGSGGTQRLPRLIGVSTALDMILTGKQLRAKQAL
KVGLVDEVVPQTILLEAAVELAKKDSSAHRVLPVRERVLAGPLGRALLFRMVSKKTAQKT
QGNYPATDRILEVIETGLAQGSSSGYEAEARAFGELAMTSQSKALRNIFFANTDVKKDPG
SEAKPGPLNSVGILGGGLMGGGIAYVTACKGGLPVRIKDINAKGINHALKYSWEQLETKV
RRRHIKASERDKQLALISGTTDYRGFAHRDLIIEAVFEDLSLKQQMVAEVEQNCAPHTIF
ASNTSSLPIGDIAANATRPEQVIGLHFFSPVEKMPLVEVIPHATTSEQTIATTVKLAKKQ
GKTPIVVQDKAGFYVNRILAPYINEAIRMLTEGERVETIDAALVKFGFPVGPIQLLDEVG
IDTGTKIIPVLEAAYGERFSAPANVVASILNDDRKGRKNGRGFYLYGAKGRKSKKQVDPA
IYTLIGVQGQGQLTAPQIAERCVMLMLNEAARCFGEQVVRSARDGDIGAVFGIGFPPFLG
GPFRYMDYLGTGEVVAVLQRLSTQYGSRFTPCEQLLQMAERGERFWDIGETDLNS
NT seq 2148 nt NT seq  +upstreamnt  +downstreamnt
atggaaatgacatcggcttttacactcaacgtgcgtctggataacgtcgccgttgtctcc
attgatgtgcccggagagaaaatgaacacccttaaagcagagtttgcttctcaggtgcgg
gctattctgaaacaaatccgcgataacaaagcattgcgtggtgtggtgtttatttcggct
aaacccgataacttcattgccggggcggatatcaacatgattggtagctgtcgcagcgcg
caggaagccgaaacgctggcccgtcaggggcagcagatcatggcagaaattaatgcattg
ccgatcccggttgttgccgctattcatggtgcctgtttgggcggtgggctggagatggcg
ctggcgtgccacaaccgtatttgtaccgatgatgctaaaaccgtactggggttgccggaa
gtacagttaggcctgcttcccggttccgggggcacccagcgattaccccgtcttattggt
gtcagtactgcgctggatatgatcctgacaggaaaacagctccgggcaaaacaggcgcta
aaagtggggttggtggatgaagttgtaccacagaccattttgctggaagccgcggttgaa
ctggccaaaaaagacagctcggcacaccgggttctgcccgtacgtgaacgcgtgctggcg
gggccgctgggacgtgcgctgctgtttcgtatggtcagcaaaaagacggcgcaaaaaacg
cagggcaactaccctgcgacggaccgcattcttgaggtgatcgaaaccggtctcgcgcag
ggcagcagcagcggctatgaggcggaagcccgcgcgtttggcgagctggcgatgacttcg
cagtctaaggcgctacggaacatcttttttgccaataccgatgtaaaaaaagatcccggt
agtgaagcgaagcccggcccgctgaatagcgtcggtattttgggcggtggcctgatgggc
ggcggtattgcttacgtcacagcctgtaaaggtggcttgccggtgcgcatcaaagatatt
aatgctaagggaatcaaccacgcgctgaagtacagttgggagcagcttgaaacgaaggtt
cgccgccgtcatatcaaagccagcgagcgtgataaacagctggcgttgatttcgggaacc
accgattatcgcggttttgcgcatcgcgatctgattattgaagcggtattcgaagatctg
tcgttaaaacaacagatggtggcagaagttgagcagaattgtgcccctcatactattttt
gcgtcaaacacctcatctttaccgattggcgatattgcggctaatgctaccagacctgaa
caggtaattggtctgcacttctttagcccggtagaaaaaatgccactggtggaagtgatt
ccgcatgcaacaacctctgagcagacgattgccacaaccgttaagttagcgaaaaagcag
ggcaaaacgccgattgttgtccaggataaggctggcttttacgttaaccgtattttagcg
ccttacatcaacgaagcgattcgtatgctgaccgaaggcgagcgcgtcgagacgattgat
gccgcgctggttaagtttggttttccggtagggccaatccaacttttggatgaggtcgga
attgatacgggcactaaaattataccagtgcttgaggccgcctatggagaacgttttagc
gcacctgcaaatgttgttgcttcaattttgaatgatgatcgcaaaggtagaaaaaatggt
cggggtttctatctttatggcgcgaaagggcgtaaaagcaaaaaacaggtcgaccctgca
atttatacgcttattggcgtccagggtcagggccaactcacagccccgcaaattgcagag
cggtgtgtcatgttaatgcttaacgaagcagcacgctgttttggtgagcaggtcgtccgt
agcgcacgtgatggcgatatcggcgctgtatttggtattggttttccgccattcctcggc
ggcccgttccggtatatggattatctcggtacgggtgaagtggttgcggttctgcaacga
ctgtccacgcaatatggttcacggtttacgccgtgtgaacagttattgcagatggcggaa
cgtggtgaaagattctgggatatcggggaaactgacctgaattcatga

DBGET integrated database retrieval system