KEGG   Citrobacter sp. FDAARGOS_156: AL515_17935Help
Entry
AL515_17935       CDS       T04313                                 

Definition
(GenBank) 4-aminobutyrate--2-oxoglutarate transaminase
  KO
K07250  4-aminobutyrate aminotransferase / (S)-3-amino-2-methylpropionate transaminase [EC:2.6.1.19 2.6.1.22]
Organism
cif  Citrobacter sp. FDAARGOS_156
Pathway
cif00250  Alanine, aspartate and glutamate metabolism
cif00280  Valine, leucine and isoleucine degradation
cif00410  beta-Alanine metabolism
cif00640  Propanoate metabolism
cif00650  Butanoate metabolism
cif01100  Metabolic pathways
cif01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:cif00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    AL515_17935
   00650 Butanoate metabolism
    AL515_17935
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    AL515_17935
   00280 Valine, leucine and isoleucine degradation
    AL515_17935
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    AL515_17935
Enzymes [BR:cif01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     AL515_17935
    2.6.1.22  (S)-3-amino-2-methylpropionate transaminase
     AL515_17935
Amino acid related enzymes [BR:cif01007]
 Aminotransferase (transaminase)
  Class III
   AL515_17935
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: AMH15625
LinkDB All DBs
Position
3839365..3840648
Genome map
AA seq 427 aa AA seqDB search
MSTNKELMQRRSNAVPRGVGQIHPIFAERAENCRVWDVEGREFLDFAGGIAVLNTGHLHP
QIVSAVEAQLKKLSHTCFQVLAYEPYLELCEIMNKKVPGDFAKKTLLVTTGSEAVENAVK
IARAATKRTGTIAFSGAYHGRTHYTLSLTGKVNPYSAGMGLMPGHVYRALYPCPLHGISD
DDAIASIHRIFKNDAAPEDVAAIVIEPVQGEGGFYAASPAFMQRLRAICDEHGIMLIADE
VQSGAGRTGTLFAMEQMGVAPDLTTFAKSIAGGFPLAGVTGRADVMDAIPPGGLGGTYAG
NPIACAAALAVLNIFEQENLLQKANDLGKTLREGLLAIAETHREIGDVRGLGAMIAIELF
EDGDHTKPDAKLTAEIVARARDKGLILLSCGPYYNVLRILVPLTIEDAQIRQGLDIIAQC
FAEAKQG
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
atgagcaccaacaaagaactcatgcaacgtcgcagcaacgccgttccccgtggcgtaggc
cagatccatccaattttcgccgagcgtgcagaaaactgtcgggtctgggacgttgaaggc
cgtgaattcctcgattttgccggaggtattgcagtgttgaataccgggcacctgcatccg
cagattgtctctgcggtagaagcgcagttgaaaaagctgtcccatacctgtttccaggta
ctggcctatgagccatacctggagctgtgcgaaatcatgaacaagaaagtgccgggtgat
ttcgccaagaaaacactgctggtcaccaccggctccgaagcggtggaaaacgcggtaaaa
atcgctcgcgccgccaccaaacgtaccgggaccatcgcctttagcggtgcttaccacggc
cgtacccactacaccctgtcgctgacagggaaagtgaacccatactctgccggaatggga
ctgatgccgggccacgtgtatcgcgcgctttacccgtgcccgctgcacggcatcagtgac
gacgatgctatcgccagcattcatcgcatcttcaaaaacgatgccgcgccggaagacgtt
gccgccatcgtgattgaacccgttcagggcgaggggggtttttacgccgcctcgccggcc
tttatgcagcgcctgcgcgccatttgtgacgaacacgggatcatgctgattgccgatgaa
gtacagagcggcgcgggtcgtaccggtacgttgtttgccatggagcagatgggcgttgcg
cccgatctcaccaccttcgctaaatccatcgccggaggcttcccgctcgcaggtgtgacc
ggacgcgccgacgtcatggacgctattccaccgggtggtctgggcggtacctatgccggt
aacccgattgcctgtgccgccgcgctggcggtactgaacattttcgagcaggaaaatctg
ctgcaaaaagccaacgatctggggaaaaccctgcgtgaaggcctgctggctatcgcggaa
acccaccgcgagattggcgacgtacgcgggctgggggcgatgattgctatcgaactgttc
gaagatggcgaccacacgaaaccagacgctaaactgaccgccgaaattgtcgcgcgtgcg
cgagataaagggctgatcctgctctcctgcgggccttactacaacgtgctgcgcatcctt
gtcccgttgaccattgaagatgcgcaaatccgccaggggctggacattatcgcccagtgt
tttgccgaggcaaaacagggttaa

DBGET integrated database retrieval system