KEGG   Citrobacter sp. FDAARGOS_156: AL515_20555
Entry
AL515_20555       CDS       T04313                                 

Definition
(GenBank) galactitol-1-phosphate 5-dehydrogenase
  KO
K00094  galactitol-1-phosphate 5-dehydrogenase [EC:1.1.1.251]
Organism
cif  Citrobacter sp. FDAARGOS_156
Pathway
cif00052  Galactose metabolism
cif01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cif00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    AL515_20555
Enzymes [BR:cif01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.251  galactitol-1-phosphate 5-dehydrogenase
     AL515_20555
SSDB
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C AlaDh_PNT_C ADH_zinc_N_2 MTS TrkA_N 2-Hacid_dh_C UDPG_MGDP_dh_N Methyltransf_25 PrmA Methyltransf_31 Pyr_redox_2 CoA_binding ELFV_dehydrog Methyltransf_11 Pyr_redox Met_10 3HCDH_N Shikimate_DH Methyltransf_24 Fer4_4
Other DBs
NCBI-ProteinID: AMH16108
LinkDB
Position
4395188..4396231
AA seq 347 aa
MKSVVIHAEGDVRVEERPMPQLQADNDVLVRVVSSGLCGSDIPRIFSHGAHYYPITLGHE
FSGYVESYGTGVTDMQPGDAVACVPLLPCFHCPQCERGYFSLCKQYQFVGSRSEGGNAEY
VVVKRANLFRLPSDMPIDDGAFIEPITVGLHAFHLAQGCEGKNVIIVGAGTIGLLAMQCA
RELGAKSVTAIDINPQKLTLAKELGATHVFNSREMGAAEIYSALADLQFDQLVLETAGTP
QTVALSVEIAGPRAQVALVGTLHQDLTLTSSVFGQILRKELTILGSWMNYSSPWPGEEWE
TAARLLTEKRLQLEPLIAHSGDADSFAKAVTSLNGAPMQGKILLKFA
NT seq 1044 nt   +upstreamnt  +downstreamnt
atgaaatcagtggttattcacgctgagggagacgtacgcgttgaagaacgtcccatgccc
caactgcaagccgataacgatgtattggtcagggtggttagttcaggactttgcggttct
gatatcccgcgtattttctctcatggtgcgcattattacccaataacgctgggtcatgaa
tttagcggttatgttgaatcctacggcactggcgttactgatatgcaaccaggcgacgcc
gttgcctgtgtgccgctgctcccctgcttccactgtcctcagtgtgagcgtggttacttt
tcgttgtgtaagcagtatcagtttgtcggttcacgtagcgaaggcggcaacgcagaatat
gtggtggtgaaacgcgctaatctgttccgcctgccttcagatatgccgattgatgacggg
gcattcatcgaaccgattaccgtcggtttgcacgccttccatctggcccagggctgcgaa
ggtaaaaacgtgattatcgttggcgcaggcactatcggtttgctggcgatgcaatgtgcc
cgcgaactcggtgcaaaaagtgtcacggcaattgatatcaacccacaaaaattgacgtta
gcgaaagagttgggagccactcacgtattcaatagccgggagatgggcgcggcggaaatc
tattctgcactggccgatttgcagttcgatcagcttgtactggagacagcaggaacacca
caaaccgtagccctgtctgtagaaattgcaggccctcgcgcacaggtagcgttagtgggt
acattgcatcaggacctgacgctgacttccagtgtatttggccaaatactgcgtaaggaa
ttaaccattctcggcagttggatgaactactccagcccatggccaggagaggagtgggaa
accgctgcacgcttgctgaccgaaaaacgtttacagctggagccgttaattgcccatagc
ggcgatgctgacagttttgccaaagcggtaacatcactcaatggcgcaccgatgcaggga
aaaattctgctcaaatttgcctga

DBGET integrated database retrieval system