KEGG   Citrobacter sp. FDAARGOS_156: AL515_21785Help
Entry
AL515_21785       CDS       T04313                                 

Definition
(GenBank) glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
cif  Citrobacter sp. FDAARGOS_156
Pathway
cif00564  Glycerophospholipid metabolism
cif01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cif00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    AL515_21785
Enzymes [BR:cif01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     AL515_21785
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_oxidored Pyr_redox_2 NAD_binding_8 3HCDH_N FAD_binding_2 Lycopene_cycl GIDA
Motif
Other DBs
NCBI-ProteinID: AMH16332
LinkDB All DBs
Position
4633720..4635228
Genome map
AA seq 502 aa AA seqDB search
METKDLIVIGGGINGAGIAADAAGRGLSVLMLEAQDLACATSSASSKLIHGGLRYLEHYE
FRLVSEALAEREVLLKMAPHIAFPMRFRLPHRPHLRPAWMIRIGLFMYDHLGKRTSLPSS
TGLRFGADSVLKPEIVRGFEYSDCWVDDARLVLANAQMVVRKGGEVLTRTRATSARRENG
LWIVEAEDIDTGKKHTWQARGLVNATGPWVKEFFDDGMHLPSPYGIRLIKGSHIVVPRVH
TQKQAYILQNEDKRIVFVIPWMDEFSIIGTTDVEYKGDPKAVKIDESEINYLLKVYNAHF
KKQLGRDDIVWTYSGVRPLCDDESDSPQAITRDYTLDIHDENGKAPLLSVFGGKLTTYRK
LAEHAMEKLASYYQGIGPAWTKECILPGGDIGGDREDYAAKLRRRYPFLTESLARHYSRT
YGSNTEWIIGEATSLAELGEDFGHEFYEAELKYLVDHEWVRRADDALWRRTKEGMWLNAE
QQSRMTQWLAEYIEKRQLSLAS
NT seq 1509 nt NT seq  +upstreamnt  +downstreamnt
atggaaaccaaagatctgattgtgataggtggaggcatcaacggtgccggtatcgcggca
gatgccgctggacgcggattatccgtgctgatgctggaagcacaggatttagcctgcgcg
acctcctccgccagctccaaactcatccacggtggcctgcgctacctggaacactacgaa
tttcgtctggtgagcgaagcgctggccgaacgtgaagtgctgttgaaaatggcaccgcat
atcgccttcccaatgcgctttcgtctgccccatcgcccgcatctgcgtccggcgtggatg
atccgtattggtctgtttatgtacgatcatctgggcaaacgcaccagtttgccgagttct
accggtttgcgttttggcgcggactccgtactgaaacctgagattgtgcgcggtttcgaa
tattctgactgctgggtagacgatgcacgactggttttggcaaatgcccaaatggtcgta
cgcaaaggcggagaagtattaacccgcactcgcgccacctctgctcgccgtgaaaacggt
ttgtggattgttgaagctgaagatatcgataccggcaaaaaacacacctggcaggcgcgc
ggtctggtcaacgctaccggtccgtgggtgaaagagttctttgacgacggtatgcaccta
ccatcgccgtacggtattcgcctgattaaaggcagccacatcgtggtgccgcgcgtacat
acccagaaacaggcttacatcctgcaaaacgaagataaacgtattgtgtttgtcatccca
tggatggacgaattctcgatcatcgggacgaccgacgtcgaatacaaaggcgatccaaaa
gcagtgaaaattgatgagagtgaaatcaattacctgctgaaggtctacaacgcgcacttt
aagaaacagctgggccgtgatgatatcgtctggacttactcaggcgtgcgcccgctgtgc
gacgacgagtccgactcgccgcaggctatcacccgtgattacacgctggatatccatgat
gaaaacggcaaagcgccgctgctgtcggtctttggcggcaagctgacgacctaccgtaag
ctggctgaacatgcgatggaaaaactggcgtcgtactatcagggcattggtccggcgtgg
acgaaagagtgcattctgccaggcggtgacatcggcggcgatcgcgaggattacgcggcc
aaactgcgccgtcgctacccgttcctgaccgagtcgctggcgcgccattattcgcgtacc
tacggcagcaacaccgaatggattatcggcgaagccacctcacttgccgagttaggtgaa
gactttggccatgagttttatgaggccgagctgaaatatctggtcgatcacgaatgggtc
cgtcgtgcggacgatgcgctgtggcgtcgtacgaaagaagggatgtggctgaatgcagaa
cagcagtcgcgcatgacccagtggctggcggagtacattgagaagcgccaactgtcgctg
gcgtcctga

DBGET integrated database retrieval system