KEGG   Citricoccus sp. SGAir0453: E7741_13195Help
Entry
E7741_13195       CDS       T05972                                 

Definition
(GenBank) aminotransferase class III-fold pyridoxal phosphate-dependent enzyme
  KO
K00823  4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
cig  Citricoccus sp. SGAir0453
Pathway
cig00250  Alanine, aspartate and glutamate metabolism
cig00410  beta-Alanine metabolism
cig00640  Propanoate metabolism
cig00650  Butanoate metabolism
cig01100  Metabolic pathways
cig01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:cig00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    E7741_13195
   00650 Butanoate metabolism
    E7741_13195
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    E7741_13195
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    E7741_13195
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:cig01007]
    E7741_13195
Enzymes [BR:cig01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     E7741_13195
Amino acid related enzymes [BR:cig01007]
 Aminotransferase (transaminase)
  Class III
   E7741_13195
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3
Motif
Other DBs
NCBI-ProteinID: QCQ96384
UniProt: A0A4P8Q3G7
LinkDB All DBs
Position
complement(3023138..3024433)
Genome map
AA seq 431 aa AA seqDB search
MTSLSPVLKQATPVVVDHALGSWIFGTDGREYLDFTTGIGVTSTGHCHPRVVEAAREQVG
RIIHAQYTTVMHRPLLELTGRLGEVLPAGLDSVFYANSGSEAVEAAVRLARMATGRPNVV
VFQGGFHGRTVAAASLTTAGTRFSAGFAPLMAGVHMSAFPYAYRYGWDEATAVEFALREL
DYLLRTRTAPEDTAAFLIEPALGDGGYLPTPPAFLEGLRERADHHGIQLVVDEVQAGVGR
TGRFWGHQHSAAVPDILITAKGIASGFPISAIAAPTETMAKAWPGSQGGTYGGNAVSAAA
GVATLDVVRDEGLVENSRVRGEQLQAGLREVQRRFPVIGDVRGLGLMQGIEFTAADGTPD
AATATAVQQATTGHGLLTLTCGPSGNVVRLIPALVVTEGEIALGLERLEAAVASVVGAVP
AGAAAVPAAGA
NT seq 1296 nt NT seq  +upstreamnt  +downstreamnt
atgacgtccctgagccccgtcctcaagcaggccacccccgtggtcgtggaccacgccctc
ggcagctggatcttcggcaccgacgggcgcgagtacctcgacttcaccaccggcatcggc
gtgacgagcaccggccactgccatccgcgggtggtggaggccgcccgcgagcaggtgggc
cggatcatccacgcccagtacacgaccgtgatgcaccggccgctgctggagctcaccggg
aggctgggcgaggtgctgcccgccggcctggactcggtgttctacgccaactccggctcg
gaggcggtggaggccgccgtccggctggcccgcatggcgacggggcggccgaacgtcgtc
gtcttccagggcgggttccacggccgcacggtcgcggccgcctccctcaccacggccggc
acccggttctcggccgggttcgcccccctgatggccggcgtgcacatgtccgccttcccc
tacgcctaccgctacggctgggacgaggcgaccgcggtcgagttcgccctgcgggagctg
gactacctgctgaggacccgcaccgccccggaggacacggcggccttcctcatcgagccc
gccctgggggacgggggctacctgcccacgccgccggcgttcctggagggactgcgggag
cgggccgaccaccacggcatccagctggtcgtcgacgaggtgcaggccggcgtcgggcgc
accgggaggttctggggccaccagcactccgccgccgtcccggacatcctcatcaccgcc
aagggcatcgcctccggcttccccatctcggcgatcgccgcacccaccgagaccatggcc
aaggcctggccgggctcccagggcggcacctacggcggcaacgcggtctccgccgcggcc
ggcgtggccaccctggacgtcgtccgggacgagggcctggtggagaactcccgggtgcgc
ggtgagcagctccaggcggggctgcgggaggtccagcgccggttcccggtcatcggggac
gtccgcgggctgggcctgatgcagggtatcgagttcacggccgcggacggcaccccggac
gccgcgacggccaccgccgtccagcaggccaccacggggcacgggctgctcaccctgacg
tgcgggccgtccggcaacgtggtgcgcctcatcccggccctcgtggtcacggagggcgag
atcgcgctgggcctggagcgcctcgaggcggccgtggcgtccgtcgtcggggccgtcccc
gccggtgccgccgccgtccccgccgccggcgcgtga

DBGET integrated database retrieval system