KEGG   Chryseobacterium sp. IHB B 17019: ATE47_06660Help
Entry
ATE47_06660       CDS       T04193                                 

Definition
(GenBank) pyruvate dehydrogenase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
cih  Chryseobacterium sp. IHB B 17019
Pathway
cih00010  Glycolysis / Gluconeogenesis
cih00020  Citrate cycle (TCA cycle)
cih00620  Pyruvate metabolism
cih01100  Metabolic pathways
cih01110  Biosynthesis of secondary metabolites
cih01120  Microbial metabolism in diverse environments
cih01130  Biosynthesis of antibiotics
cih01200  Carbon metabolism
Module
cih_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:cih00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ATE47_06660
   00020 Citrate cycle (TCA cycle)
    ATE47_06660
   00620 Pyruvate metabolism
    ATE47_06660
Enzymes [BR:cih01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     ATE47_06660
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 GCV_H DUF2118 PYNP_C DUF2254
Motif
Other DBs
NCBI-ProteinID: ALR30226
LinkDB All DBs
Position
1471560..1473173
Genome map
AA seq 537 aa AA seqDB search
MAEVITMPRLSDTMTEGKVAKWHKKVGDTVKEGDILAEIETDKAVQDFESEMNGTLLYVG
VEEGNAAAVDSVLAIIGNEGEDISGLTGGAAAPSASVSEEKKSEEENKTENNATSVEQTS
AEVPAGVEVITMPRLSDTMTEGKVAKWHKNVGDTVKEGDLLAEIETDKAVQDFESEFNGV
LLKQGVEEGGAAPVDSVLAIIGPEGTDVSGVGAAKTETKSAEKPAEQKTEAKVEEKAAPA
VSSSSSERVAISPLAKKMAEDKGVDIHSLQGSGENGRIVKKDIENYQPSAKPAASAPSAS
PAAQVAVSFVQGEDTETPNSQVRSIIAKRLAESKFTAPHYYLMVEINMDKAIEARKEINS
LPDTKISFNDMIIKATAVALRKHPQVNSSWAGDKIIHRGNINIGVAVAIPDGLVVPVLKN
TDQMNYTQISAAVKDMAGRAKSKGLKANEMEGSTFSISNLGMFGIETFTSIINQPNSAIL
SVGAIIEKPIVKDGQIVVGNIMKLSLACDHRVVDGATGAQFLQTLKTYLESPLTLLL
NT seq 1614 nt NT seq  +upstreamnt  +downstreamnt
atggcagaagtaattacaatgccacgtctttccgatacaatgacggaaggaaaggtggca
aaatggcataaaaaagtaggagatacagtaaaggaaggagatattttagctgaaatcgaa
acagataaagcggttcaggattttgaatctgaaatgaacggaactcttctgtatgtaggt
gtagaagaaggaaatgctgcagctgtagattctgtgctggcaattatcggaaatgaagga
gaagatatttcaggattaacgggtggggctgctgctccgtctgcaagtgtctctgaagag
aaaaaatctgaagaagaaaataaaacagaaaataatgctacaagcgtagagcaaacttct
gcggaagttcctgcaggagtagaagtgattacaatgccgagactttctgatacaatgaca
gaaggtaaagtggcgaaatggcacaaaaatgtaggcgatacagtaaaagaaggtgatctt
cttgctgagatcgaaacagataaagccgttcaggattttgaatctgaatttaatggagta
ctgttgaagcaaggtgttgaagaaggtggcgcagctcctgtggattctgtattagctatc
atcggacctgaaggaacagacgtttcaggagttggtgcagcaaaaacagaaaccaaatca
gcagaaaaaccggctgagcaaaaaactgaagctaaagtagaagaaaaagcagctccggct
gtaagttcttcatcttctgaaagagttgcaatctctccattagctaaaaaaatggctgag
gataaaggagttgatattcacagtcttcagggttcgggtgaaaatggaagaatcgttaaa
aaagatattgaaaactatcagccatctgcaaaacccgcagcttcagctccgtctgcaagc
ccagcggctcaggttgcagtaagttttgttcagggcgaagatacagaaactccaaactct
caagtaagaagtatcattgcgaaacgtcttgcggaaagtaaatttacggcgccacactac
tatttaatggtagaaatcaatatggataaagctattgaggccagaaaagaaatcaattct
ttaccggataccaaaatttctttcaacgatatgatcattaaagcgactgcagttgcctta
agaaaacaccctcaggtaaattcaagctgggcaggtgacaagatcattcacagaggaaat
atcaatattggcgtagcggttgcaattcctgacggattggtagttccagtgcttaagaat
acagaccagatgaactatactcagatttctgctgctgtaaaagatatggccggaagagca
aaatctaaaggtcttaaggcaaacgaaatggaaggttccacattctctatctctaacttg
ggaatgttcggaattgaaacatttacaagtatcatcaaccaaccaaactctgcgatcctt
tcagtaggagcaattatagaaaaaccgatcgtaaaagacggacaaatcgtagttggaaat
atcatgaagctttcattagcttgtgatcacagagtggtagacggtgctacaggtgctcag
ttcttacagacattaaaaacatatttagaaagtcctttaactttgttactgtaa

DBGET integrated database retrieval system