KEGG   Chryseobacterium sp. IHB B 17019: ATE47_15070Help
Entry
ATE47_15070       CDS       T04193                                 

Definition
(GenBank) FAD-dependent oxidoreductase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
cih  Chryseobacterium sp. IHB B 17019
Pathway
cih00564  Glycerophospholipid metabolism
cih01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cih00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    ATE47_15070
Enzymes [BR:cih01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     ATE47_15070
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 FAD_oxidored GIDA Thi4 HI0933_like Pyr_redox_3 NAD_binding_8 Pyr_redox_2 FAD_binding_3
Motif
Other DBs
NCBI-ProteinID: ALR31753
LinkDB All DBs
Position
3260734..3262332
Genome map
AA seq 532 aa AA seqDB search
MKRNEELSKLSTVKEWDFIVIGGGASGLGSALDAVSRGFKTVLLESHDFAKATSSRSTKL
VHGGVRYLAQGDIGLVKEALKERGLLAKNAAHVVKNQSFIIPNYTWWGGIYYKIGLSVYD
FLAGKLSLGRTKYISKSKTIEKLPTIEQKNLASGVVYQDGQFDDARLAINLAQTIIEKGG
SAINYVKVINLIKNESNKITGVVVEDQFTKQQYNIYAKVVINATGVFTNDILNMNNPKHG
KYVVPSQGIHLVLDKSFLKSDDAIMIPKTSDGRVLFVVPWHDRALVGTTDTLLENESFEP
RALEEEINFVLNTARQYLSKKPTREDVKSVFAGLRPLAAPKDGSKNTKEVSRSHKVVTSE
TGLISIIGGKWTTYRKMAEDTINEAMKFHKLGNTTSKTQNMSVHGNVRAETVDRTNHLYV
YGSDIPKIKALQHNNPEYAEKIHSDHPFTVAEAVWAIQNEMAETIEDILARRVRLLFLDA
RAAIDSAHTIALIIAKENGHSAEWANEQAKEFIELAKGYLLTPYSPKSINLN
NT seq 1599 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgaaatgaagaactcagcaaactatccactgtcaaagaatgggactttattgtc
attggtggtggagcgagcggtttaggttcagcattggatgcggtaagcagaggttttaaa
acagtattgctggaatctcatgatttcgcaaaagcaacatccagcagaagcacgaaatta
gttcatggaggagtaagatacctggcgcagggcgatatcggccttgtaaaagaagcctta
aaggaaagaggtttattggcgaaaaatgcggcccatgttgtaaaaaatcagtcttttatt
atccccaactacacttggtggggtgggatttattataaaataggactgtctgtctatgac
ttccttgccggaaaattaagcttaggcagaacaaaatatatcagcaaatccaaaacaatt
gagaaactcccgaccattgagcagaaaaaccttgccagcggagtcgtttatcaggatggg
cagtttgatgatgcaagattggcaattaacctggctcaaaccattattgaaaaaggagga
agcgctattaattatgttaaggttattaatttaattaaaaatgaatccaataagataacc
ggtgttgtcgtggaagatcaattcacgaaacagcaatataatatctatgcaaaagtcgtt
atcaatgcaacaggggttttcaccaatgatattttaaatatgaataatcccaagcatgga
aaatacgttgttcctagccagggaatccatttggttttagacaaatcattcttaaaaagt
gacgatgcgatcatgattcccaaaacttcagacggcagagtgttgtttgtcgtcccgtgg
catgacagggctttggtaggtacaaccgatactttattggaaaacgaaagttttgagccc
cgcgctttggaagaggaaattaatttcgttttaaatacagcaagacaatatttaagcaaa
aagccgacccgggaagatgtaaaatcagttttcgcaggactaaggcctttagcagcacca
aaagacgggagcaaaaacacaaaagaagtatccagaagccataaagtagtaacatccgaa
acgggattaatctcaattatagggggaaaatggactacctatcggaaaatggcggaagac
accatcaatgaagccatgaagttccacaaattaggaaacactacttccaagacacaaaac
atgtctgttcatggaaatgtaagagctgaaaccgttgacagaacaaaccatctgtacgtt
tacggttccgatattccgaagataaaagctttacagcacaacaatcctgaatatgctgaa
aaaatacattctgaccatccgtttactgttgccgaagcagtttgggccattcaaaatgaa
atggcagaaaccattgaagatattctggccagaagagttcgtctcctgtttttagatgcc
agagctgcaatagacagtgcacatacaattgcattaattatcgcaaaagaaaacggacat
tcagcagaatgggccaatgaacaggcaaaagaatttatcgaactcgcaaaaggatattta
ctaacaccttattccccgaaatcaatcaaccttaattaa

DBGET integrated database retrieval system