KEGG   Corynebacterium imitans: CIMIT_01740Help
Entry
CIMIT_01740       CDS       T03237                                 

Definition
(GenBank) elongation factor Tu
  KO
K02358  elongation factor Tu
Organism
cii  Corynebacterium imitans
Brite
KEGG Orthology (KO) [BR:cii00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:cii03012]
    CIMIT_01740
   03029 Mitochondrial biogenesis [BR:cii03029]
    CIMIT_01740
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cii04147]
    CIMIT_01740
Translation factors [BR:cii03012]
 Eukaryotic Type
  Elongation factors
   CIMIT_01740
 Prokaryotic Type
   CIMIT_01740
Mitochondrial biogenesis [BR:cii03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    CIMIT_01740
Exosome [BR:cii04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   CIMIT_01740
  Exosomal proteins of breast cancer cells
   CIMIT_01740
  Exosomal proteins of colorectal cancer cells
   CIMIT_01740
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 RsgA_GTPase
Motif
Other DBs
NCBI-ProteinID: AIJ32799
UniProt: A0A076NEA0
LinkDB All DBs
Position
382073..383263
Genome map
AA seq 396 aa AA seqDB search
MAKEKFERSKPHVNIGTIGHVDHGKTTTTAAITKVLADQYPEENKAFDYAMIDKAPEERE
RGITINISHVEYNTPKRHYAHVDAPGHADYIKNMITGAAQMDGAILVVAATDGPMPQTRE
HVLLARQVGVPYILVALNKCDMVDDEEIIELVEMEVRELLAEQDYDEEAPIVQISALKAL
EGEEKWVQSVVDLMQACDDSIPDPERETDKPFLMPVEDIFTISGRGTVVTGRVERGVLNV
NDEVEIIGIRDKATKTTVTSIEMFNKLLDTAEAGDNAALLLRGLKREDVERGQVIIAPGA
YTPHSKFEGSVYVLSKDEGGRHTPFFDNYRPQFYFRTTDVTGVVKLPEGTEMVMPGDNVD
MSVELIQPVAMDEGLRFAIREGSRTVGAGRVTKILD
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
gtggcaaaggaaaagttcgagcgctctaagccgcacgtgaacatcggcaccatcggtcac
gtcgaccacggcaagaccaccaccaccgccgcgatcaccaaggtgctggcagaccagtac
ccggaggagaacaaggccttcgactacgcgatgatcgataaggctccggaggagcgcgag
cgtggtattaccatcaacatctcccacgtggagtacaacaccccgaagcgccactacgca
cacgttgacgctccgggccacgccgactacatcaagaacatgatcaccggtgcggcacag
atggacggcgctatcctcgttgtcgctgcgaccgacggcccgatgccgcagacccgcgag
cacgtgctgctcgctcgccaggttggcgttccgtacatcctcgttgcactgaacaagtgc
gacatggtcgacgatgaggagatcatcgagctcgtcgagatggaggtccgcgagctgctg
gctgagcaggactacgacgaggaagctccgatcgtccagatctccgctctgaaggctctc
gagggcgaggagaagtgggtacagtccgttgttgacctcatgcaggcctgcgacgactcc
atcccggatccggagcgcgagaccgacaagccgttcctgatgccggtggaggacatcttc
accatttccggccgcggcaccgtcgtgaccggccgtgtcgagcgcggtgtcctcaacgtc
aacgatgaggttgagatcatcggtatccgcgacaaggccaccaagaccaccgtcacctcc
atcgagatgttcaacaagctcctcgacaccgccgaggctggcgacaacgctgcactgctg
ctccgtggcctcaagcgtgaggacgttgagcgtggtcaggtcatcatcgctccgggtgct
tacaccccgcactccaagttcgagggttccgtctacgtcctgtccaaggatgagggcggc
cgccacaccccgttcttcgacaactaccgtccgcagttctacttccgcaccaccgacgtg
accggtgttgtgaagctgccggagggcaccgagatggtcatgccgggcgacaacgtcgac
atgtccgtcgagctcatccagccggtcgctatggacgagggcctgcgcttcgctatccgc
gagggctcccgcaccgttggcgctggccgcgtcaccaagatcctcgactaa

DBGET integrated database retrieval system