KEGG   Corynebacterium imitans: CIMIT_02405Help
Entry
CIMIT_02405       CDS       T03237                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
cii  Corynebacterium imitans
Pathway
cii00620  Pyruvate metabolism
cii00680  Methane metabolism
cii01100  Metabolic pathways
cii01120  Microbial metabolism in diverse environments
cii01200  Carbon metabolism
Module
cii_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:cii00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    CIMIT_02405
  09102 Energy metabolism
   00680 Methane metabolism
    CIMIT_02405
Enzymes [BR:cii01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     CIMIT_02405
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-ProteinID: AIJ32910
UniProt: A0A076NM46
LinkDB All DBs
Position
505428..508076
Genome map
AA seq 882 aa AA seqDB search
MSVQPADHVREDIRLLGRVLGRVLAEQEGQEIFDLVESTRRTAFDIAHGDAAPEDLLAVF
RDMDITKMNLVARAFSHFALLTNLVEDLDDEKAAAPVSLRTSFAHLKDSGVDADKVAELI
AGAQVSPVLTAHPTETRRRTVFDTQTHIKRLLSELHAGADPAAIEREMELRMTLLWQTAL
IRIARPRLEDEIDVGLRYYKLSLLEQIPALNRAIRYELRDTFDRDLALTPVMRPGSWIGG
DHDGNPYVNAETLTYATRQAADTVLNHYLDELGELERELSLSDRYSTCSAELSQLADVAN
NTAESRVDEPYRRAIYGIRHRVAATRDVLAGSASAGTPYADPGELLADLDVIDASLRAHG
GAIIANDRLNRLRSAVTTFGFHLYTLDLRQNSESFEKVVAEVLSVAGVCENYAALAEEDR
VEVLVDELRTPRPLLRAEAQLSDDTRKEMGILTAAARAVRDLGQGAIAQCIIAMTGTVSD
ILEPMVLLKEVGLGSVNVVPLFETIEDLAHGARILEDLWSLPFYREHLRARGDVQEVMLG
YSDSNKDGGYLQANWALYDAELALVELCNRHGIRLRLAHGRGGAVGRGGGPTYDAILAQP
KGAVDGSIRITEQGEIISAKYGSPETARRHLEAFVAGTLEASLLDTEPIADPTRAYDIMR
TLAAYSGEKYNELIGDPGFIDYFTQSTPLHEIGELNLGSRPASRKQTTAISDLRAIPWVL
SWAQSRTNVPGWFGVGTAVERWAGESEERWDDLRELYRDWPFFRSVLSNMAQVMAKAELS
LARLYADLVEDREVAERIYTLIAEEFERTKQVYFRITGHADLVAENQRQARSLKRRYPYL
LPLNAVQLELLRRYRAGDETFLVSKTIQVTMNGLATALRNAG
NT seq 2649 nt NT seq  +upstreamnt  +downstreamnt
gtgtccgtccagcccgccgatcacgtccgcgaagatattcgacttttgggccgggtgctc
ggccgcgtgctcgccgagcaggagggccaggagatctttgacctggtcgaatccacccgt
cgcaccgccttcgacatcgcccacggggatgccgccccagaagacctgctcgccgtcttc
cgtgacatggacatcaccaagatgaacctggttgcgcgcgcattcagccacttcgcactg
ctgactaacctggtcgaggacctggacgacgagaaggcggccgcgccggtctcgctgcgt
accagcttcgcgcacctgaaagacagcggcgtggacgccgacaaggtcgccgaacttatc
gccggggcgcaggtctccccggtgctcaccgcgcatccgaccgagactcgccgccgcacc
gtctttgacactcagacgcacatcaagcgcctgctgagcgagcttcacgctggcgccgac
ccagccgccatcgagcgcgagatggaactgcgcatgacccttttgtggcaaaccgcgctc
atccgcatcgcgcgcccgcgcctggaagacgagatcgacgtcggtctgcgctactacaaa
ctctccctgctcgagcagatcccggcgcttaaccgcgcgatccgctacgagctgcgcgac
accttcgaccgcgacctcgcccttacccccgtgatgcgccccggctcctggatcggcggc
gaccacgacggcaacccttacgtcaacgccgaaacgctcacctacgccacccgccaggcc
gccgacaccgtgttgaaccactacctcgacgaactgggcgaactcgagcgcgagctgtcc
ctctctgaccgttactccacctgctcggcggagctttcccagcttgccgacgtcgccaac
aacacagccgagtcccgcgtcgatgagccctaccgccgcgccatctacggcatccgccat
cgcgtcgccgccacccgcgacgtactcgccggttcggcaagcgcgggcacaccctacgcc
gaccccggcgaactgctcgcagacctggacgtgatcgacgcttccctgcgcgcccacggc
ggcgcgattatcgccaacgaccggctgaaccgcctgcgctcggccgtgaccaccttcggc
ttccacctctacacgctcgacctgcggcaaaactccgaatccttcgagaaagtcgtggcc
gaggtgctctcggtcgccggcgtgtgcgaaaactacgccgcgcttgcggaggaggaccgc
gtggaggtgctcgtcgatgagctgcgcaccccgcgcccgctgctgcgcgccgaggcgcag
cttagcgacgacacgcgcaaggaaatgggcatcctcaccgccgccgcacgcgccgtccga
gacctgggacaaggcgcaatcgcgcagtgcatcatcgccatgaccgggaccgtttccgac
atcctggagcccatggtcctgctcaaagaagtcggcctgggcagcgtcaacgtcgtcccg
ctgtttgagaccatcgaggacctcgcacacggcgcccgcatcctcgaagacctctggtcg
ctgccgttctaccgcgaacacctgcgcgcccgcggcgacgtccaggaagtcatgctcggc
tactccgactccaacaaggacggcggctacctgcaggccaactgggcgctttacgacgcc
gaactcgccctcgtcgaactctgcaaccgccacggcatccgccttcggctcgcgcacggc
cgcggcggggctgtcggccgcggcggcgggcccacctacgacgccatcctcgcccaacca
aagggcgccgtcgacggctccatccgcatcaccgaacagggcgagatcatctccgccaag
tacggctcgcccgagaccgcacgccgccacctcgaggccttcgtcgccggcaccctcgag
gcctccctgctggacaccgagccgatcgccgacccaacgcgtgcctacgacatcatgcgc
acactcgccgcctactccggcgaaaagtacaacgaactcatcggcgaccccgggtttatc
gactacttcacccaatccaccccgctgcacgagattggcgagctcaacctcggctcccgc
cccgcctcgcgcaaacaaaccaccgcgatctccgatcttcgcgccatcccctgggtcctg
tcctgggcgcagtcgcgcaccaacgtgcccggctggttcggcgtcggcaccgcggtcgag
cgctgggcaggcgagagcgaagagcgctgggacgatctgcgcgagctctaccgcgactgg
ccattcttccgctccgtgctgtccaacatggcccaagtcatggccaaggccgagctgtcg
ctcgcccgcctctacgccgacctggtagaagaccgcgaggtggccgagcgcatctacacg
cttatcgccgaagaatttgagcgcaccaagcaggtctacttccgtatcaccggacacgct
gacctggttgccgagaaccagcgccaggcccgctcgctcaagcgccgctacccctacctg
ctgccgctcaacgccgtccagctcgagttgcttcgccgctaccgcgccggcgacgagacc
ttcctcgtctccaagaccatccaggtcaccatgaacgggctggccaccgcgctgcgcaac
gcggggtag

DBGET integrated database retrieval system