KEGG   Corynebacterium imitans: CIMIT_05830Help
Entry
CIMIT_05830       CDS       T03237                                 

Definition
(GenBank) hypothetical protein
  KO
K00624  carnitine O-acetyltransferase [EC:2.3.1.7]
Organism
cii  Corynebacterium imitans
Brite
Enzymes [BR:cii01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.7  carnitine O-acetyltransferase
     CIMIT_05830
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Carn_acyltransf
Motif
Other DBs
NCBI-ProteinID: AIJ33477
UniProt: A0A076NRC1
LinkDB All DBs
Position
complement(1208174..1209832)
Genome map
AA seq 552 aa AA seqDB search
MPLPPLEQTLSEYATALSAMLDEEERAHASRVIEDFAHSKGPLLDAALRKRAVSREAEGT
NWLHDEWYEGYLAVRGPLQLSTNVGFQLAPFGAGTTGTQRAAAAIQRIATVHLQAAGDAL
PEDVDARGNRITLNQWFVFNGGLRHPRPDVDEVAVCTKSAADREIGIFVDGRLFALPISD
AEGNVTPHEHLAANLDTVLAAARTPSPDQADFNAAALAGDESELTELIERNPHTYQRLAD
LLFTVDLVNTSGRDDAALLADLAFRPRGAWVYKPLSYQLGLDSDWTAVHVEHTCQDGGTL
VTAVSRMQDANVQESPTLAEQAPEELRWELDHAPDTPAAPYTVELRPVDIPPTDLPFKFS
RDASAQLIMTIAQQLTYGRVRAVYEAVDMREYRAGRTECLRALTPEAAAFARALVAGTAT
REQLVAAAEAHRGWVKRCKSGNGIDRHIQMLELLDAQETGTATDPFCSDPVVTAARKDFL
STTSVGSANQIVRYAFAPTLPEGFGIAYTPLTETTKYCVSYNTETAEKPQEFLANLARAS
ELLWQFCGELDG
NT seq 1659 nt NT seq  +upstreamnt  +downstreamnt
ctgccgctgcctccgctcgagcagacactcagcgagtacgccacagcgctttcggcgatg
ctcgatgaggaggagcgtgcccacgcctcccgggtaatcgaggacttcgcgcacagcaag
ggcccgcttctcgacgctgcgttgcgcaagcgtgccgtttctcgcgaagcagagggcacg
aactggctgcacgacgaatggtatgagggctatctcgctgtccgcgggccactccaactg
agcacaaacgtcggcttccagctcgcccccttcggagccggtaccaccgggacgcagcgc
gctgccgcggccatccagcgcatcgccaccgtccacctgcaggcggccggcgacgcgctg
ccggaggatgtggacgcgcgcggtaaccgcatcacgctgaaccagtggttcgtgttcaac
ggcgggctgcgccacccgcgcccagatgtagacgaggtcgcggtctgcacgaagtcggct
gcggaccgcgagatcggcatcttcgtcgacggccgccttttcgccctccccatcagcgac
gccgagggcaacgtcaccccgcacgagcacctcgccgcaaacctggacacggtgctggcc
gccgcgcgcaccccgtctcctgaccaggcggacttcaacgcggccgcgctcgccggcgat
gagtcggagctcacggagctcatcgaacgcaacccgcacacctaccaacggcttgccgac
ctgctgttcaccgtcgatctagtcaacacttcgggacgcgacgacgccgcgctgctcgcg
gacctcgcgttccgcccccgcggtgcatgggtgtacaagccgctgagctaccagctcggc
ctcgacagcgactggaccgccgtacacgtcgaacacacctgccaggacggcggcacattg
gtcaccgcggtttcacgtatgcaggacgccaacgtgcaggagtcgcccaccctggctgag
caggcccccgaggagctgcgctgggagctcgaccacgccccagacacgccggccgccccc
tacacggtagagctgcgccccgtggacatcccgcctaccgacctgcccttcaagttcagc
cgcgacgcgagcgcccagctgatcatgacgatcgcgcagcagctcacctacggccgtgtc
cgcgccgtctacgaggccgtagacatgcgcgagtaccgcgccgggcgcaccgagtgcctg
cgtgccttgaccccggaggcggcagcgttcgcacgcgccctcgtcgcgggtaccgcgacc
cgcgagcagctcgtcgccgcggccgaagcgcaccgcggatgggtcaagcgctgcaaatcc
ggcaatgggatcgaccgccacatccaaatgctcgagctcctcgacgcccaagagactggc
acagctaccgacccgttctgcagcgatccagttgtcaccgccgcgcgcaaggacttcctg
tccaccacctccgtcggcagcgcgaaccagatcgtgcgctacgccttcgctccgacactg
ccggagggtttcggcatcgcctatactccactcacggaaaccaccaagtactgcgtgtcc
tacaacacagaaaccgcagaaaagccgcaggagtttttagctaacctcgcgcgcgcttcc
gagttgctttggcagttctgcggcgagctcgacggctaa

DBGET integrated database retrieval system