KEGG   Citromicrobium sp. JL477: WG74_04010Help
Entry
WG74_04010        CDS       T04089                                 

Definition
(GenBank) dihydroxy-acid dehydratase
  KO
K01687  dihydroxy-acid dehydratase [EC:4.2.1.9]
Organism
cij  Citromicrobium sp. JL477
Pathway
cij00290  Valine, leucine and isoleucine biosynthesis
cij00770  Pantothenate and CoA biosynthesis
cij01100  Metabolic pathways
cij01110  Biosynthesis of secondary metabolites
cij01130  Biosynthesis of antibiotics
cij01210  2-Oxocarboxylic acid metabolism
cij01230  Biosynthesis of amino acids
Module
cij_M00019  Valine/isoleucine biosynthesis, pyruvate => valine / 2-oxobutanoate => isoleucine
cij_M00570  Isoleucine biosynthesis, threonine => 2-oxobutanoate => isoleucine
Brite
KEGG Orthology (KO) [BR:cij00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00290 Valine, leucine and isoleucine biosynthesis
    WG74_04010
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    WG74_04010
Enzymes [BR:cij01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.9  dihydroxy-acid dehydratase
     WG74_04010
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ILVD_EDD Na_H_antiport_1
Motif
Other DBs
NCBI-ProteinID: ALG60110
LinkDB All DBs
Position
798244..799920
Genome map
AA seq 558 aa AA seqDB search
MTETTSKRSDAITKGAAKAPARAMLRGAGYSDEQMAQPMVAVVNTWSTVTPCNMHLADLA
EPIRQGLSENGATPVDFNTIVVSDGITMGGEGMRASLISREIIADSIELAVKGHSLDAAI
ILVGCDKTIPAAAMALARLDIPGLVFYGGTIMPGQLDGRDLSIQDVFEAVGAHAKGDMSD
AELDKVERAACPGAGACGGQFTANTMAMALAMMGISPMGSGDPPATDSAKRVEAARCGRL
AAKLAKEGTSARSFLTPASIRNAATAVVASGGSTNAVLHLPAIAAEAGFAFPIETFDELS
RSVPVITDLKPGGRFLARDLYAAGGVPLFGKRLADAGMLEDTPTVTGDSLFAELARAEET
PGQQVVKSPVDPVKATGGLSILYGDIAPEGAVLKTAGYGAASFEGPAKVFEGEEACFAAV
NANQIQAGDVVIIRYEGPSGGPGMREMLAVTAALAGQGLAGKVALITDGRFSGASHGFVI
GHCSPEAAKGGPIALVEEGDIIRIDAETRRIDADIDWDARRAAHTPRPPNSMGGVFDKYA
RLVSSAAYGATTIPPVTE
NT seq 1677 nt NT seq  +upstreamnt  +downstreamnt
atgactgagacaacttccaaacgctccgacgcaatcaccaagggtgcggccaaggcgcct
gcacgcgccatgctgcgaggtgcgggctactctgacgaacagatggcccagcccatggtc
gcggtcgtcaacacctggtcgacggtgacgccgtgcaacatgcacttggctgatctggcc
gagccgatccggcagggcctgagcgaaaacggagccaccccggtcgatttcaacaccatc
gtcgtgtccgacgggatcaccatgggcggcgagggcatgcgcgcctcgcttatcagccgt
gagatcatcgccgactcgatcgaactggcggtgaagggccattcgctggacgcggcgatc
attctggtcggctgcgacaagaccatccccgccgccgcgatggcgctggcccggctcgat
attccggggctggttttctacggcgggactatcatgcccggccagctggatggtcgcgat
ctgtcgatccaggatgtcttcgaagctgtcggcgcgcatgccaaaggcgacatgagcgat
gccgagctggacaaggtcgagcgtgcggcatgccccggcgcgggcgcgtgcggcgggcag
ttcaccgccaacaccatggcgatggcgctggcgatgatgggcatcagcccaatgggctcg
ggcgatccgcccgcgaccgactccgccaagcgggtcgaggctgcgcgctgcgggcggctg
gcggccaagctggccaaggaaggcacctcggcacgcagcttcctgacccccgcatcgatc
cgcaacgcggcgacggctgtggtggcgagcggcggctcgaccaacgccgtgctgcacctg
cccgcgatcgcggcggaggcgggctttgccttcccgatcgaaaccttcgacgaattgtcg
cgcagcgtgccggtgatcaccgacctgaagccgggcgggcgctttctggcgcgcgatctc
tacgcggcgggcggtgtcccgctgttcggcaagcggctggcggacgccgggatgctggaa
gacacccccacggtgacgggcgacagcctgtttgccgaactggcccgcgccgaggaaacg
ccggggcagcaggtggtcaaatcgcctgtcgacccggtcaaggcgaccggtggcctcagc
atcctctacggcgacatcgcccccgaaggcgcggtgctgaagaccgccggctacggcgcg
gcctcgttcgaaggcccggccaaggtgttcgagggcgaggaagcctgcttcgcggcggtc
aacgccaaccagatccaggcgggcgatgtggtcatcatccgctacgaaggcccctcgggc
gggcccggcatgcgcgagatgctagcggtgaccgccgcgctcgccgggcagggtctcgcg
ggcaaggtcgcgctgattaccgacgggcgcttttccggcgcgagccacggcttcgtgatc
ggccactgctctcccgaggcggccaagggcggcccgatcgccctggtcgaggaaggcgac
atcatccgcatcgacgcggaaacccgccggatcgacgccgatatcgactgggatgcccgc
cgcgccgcgcacactcccagaccgccaaactccatgggcggggtgttcgacaaatacgcc
cgtctcgtttcgtccgccgcctacggcgcaaccaccattccacctgttaccgagtga

DBGET integrated database retrieval system