KEGG   Citromicrobium sp. JL477: WG74_05370Help
Entry
WG74_05370        CDS       T04089                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
cij  Citromicrobium sp. JL477
Pathway
cij00620  Pyruvate metabolism
cij00680  Methane metabolism
cij01100  Metabolic pathways
cij01120  Microbial metabolism in diverse environments
cij01200  Carbon metabolism
Module
cij_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:cij00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    WG74_05370
  09102 Energy metabolism
   00680 Methane metabolism
    WG74_05370
Enzymes [BR:cij01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     WG74_05370
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2 PEP-utilisers_N
Motif
Other DBs
NCBI-ProteinID: ALG60346
LinkDB All DBs
Position
1071982..1074648
Genome map
AA seq 888 aa AA seqDB search
MATRPAIQQNPDIRYLGKLLGDVIREHGGDQLFQRTEEIRAASVERHRNEAPVDLRLDQL
DLDDTLAFVRGFGLFSMLANLAEDREGMMAEQDMPFADALASLKEQGISSEQVSEMLDQA
LVMPVLTAHPTEVRRKSVIDHRVRIAELMRMRDAQAISTPEGDDVEESIIRQIALLWHTR
TLRRERLFVTDEVENAVSFMRDSFLPAIPVLYRRWEDALGSRPASFLRVGSWIGGDRDGN
PYVTADSLRFAQAFAAETVIEYYLDALHKLGGELSLSSELTEVDPELARLADASGDDSSH
RQDEPYRRAIIGIYNRLAATFEELVGKEPSRAAIGPAEPYDSPDGLQDDLRVVARSLTKA
GGQTLASQGALGRLVRAVRTFGFHLATLDLRQNSAVHERVVGELLANAGVEEDYTALDEE
ARIALLRRELASARPLRSQWMEYGEETTKELAILEATAQAHARFGPHCITQYVVSMAETV
SDLLEVHILLKEVGLYRPGDTPHSAIQAVPLFETIGDLKNAPEVMRSYFGLPEVAAMASA
RGHQEVMIGYSDSNKDGGYLTSSWMLARASEALAPVFAEAGVTMQLFHGRGGSVGRGGGS
AFDAIRGQPSGTVNGRIRITEQGEVIAAKYGTPEVAAVNLDAMVTAAMLATMEPERVPQD
DYRRYAEAMDAVSETAFSTYRDLVYGTDGFVGFFRQMTPIAEIATLKIGSRPASRKSDDR
IENLRAIPWVFSWSQARVMLPGWYGVGTALSQFEDKALLREMAREWPFLRNALANMEMVL
AKSDMGIAERYSELVEDRDLAKGVFGAIRDEWQRTHDALLDATGQSFLLENSPRLDASIR
LRLPYIEPLNLLQVELLKRHRSGEPDERIAEGIQLSINAIATALRNSG
NT seq 2667 nt NT seq  +upstreamnt  +downstreamnt
atcgccacccgacccgcaatccagcaaaaccccgatatccgctatctcggcaagctattg
ggcgatgtgatccgcgaacatggcggcgaccagctgtttcagcggaccgaggaaatccgc
gccgccagcgtggaacgccaccgtaatgaagctccggtcgacctgcggctcgaccagctc
gatctcgacgatacgctcgccttcgtgcgcgggttcggtctgttctcgatgctcgccaac
ctcgcggaagaccgcgaggggatgatggcggagcaggacatgcccttcgccgacgcgctc
gcttcgctgaaggagcagggcatttcgagcgagcaggtctccgaaatgctcgaccaggcg
ctggtgatgccggtgctgaccgcgcaccccaccgaagtgcgccgcaagagcgtgatcgac
caccgcgtacggatcgccgagctgatgcggatgcgcgatgcgcaggcgatctccacaccc
gagggtgacgatgtcgaggaatcgatcatccgccagatcgcactgctatggcacacccgc
acgctgcggcgagagcggctgttcgtgaccgacgaggtcgagaacgcggtttccttcatg
cgagacagcttcctgcccgcgatccccgtgctctatcgccgctgggaagacgcactgggc
agccgcccggccagcttcctccgggtcggcagctggatcggcggcgaccgcgacggcaac
ccctatgtcaccgcggattcgctgcgtttcgcgcaggccttcgctgcggaaaccgtgatc
gaatattatctcgacgcgcttcacaagctgggcggtgagctttcgctgtcgagcgagctg
accgaggtcgatcccgagcttgcgcggctggccgacgcgagcggggacgactcctcgcac
cggcaggacgagccctatcgtcgtgcgatcatcgggatttacaaccgccttgccgcgacc
ttcgaggaactggtcggcaaggagccttcgcgcgcggcgatcggcccggcagagccctat
gacagccccgatggcctgcaggacgatctgcgggtggtcgcccggtctttgaccaaggcg
ggcggccagacgctcgcctcgcagggcgcgctggggcggctggtgcgggcggtgcgcacc
ttcggcttccaccttgccacgctcgacctgcggcagaacagcgcggtgcacgagcgtgtg
gtgggcgaattgctcgccaacgcgggcgtggaggaggattataccgcactcgatgaagag
gcgcgcatagccctgctgcgccgcgaacttgccagcgcgcgtccactgcggtcgcagtgg
atggagtacggcgaagagacgaccaaggaactggcgatcctcgaggcgaccgcgcaggcg
cacgcgcgcttcggcccgcattgcatcacgcaatacgtggtctcgatggcggagaccgtg
tccgacctgctcgaagtgcacatcctgctcaaggaagtcggcctttatcgtccaggcgac
acgccgcacagtgcaatccaggcggtgccgctgttcgagacgatcggcgacctgaagaac
gcgcccgaggtgatgcgcagctatttcggcctgccggaggtcgccgcgatggccagcgcg
cggggccatcaggaagtgatgatcggctattccgattccaacaaggatggcggctatctg
acctccagctggatgctcgcgcgggcgagcgaggcgctggccccggtatttgccgaggcg
ggcgtgacgatgcagctgttccacgggcgcggcggttcggttggccgcggtggcggctcc
gccttcgatgcgatccgcggccagccctcgggcacggtcaacgggcgcatccggatcacc
gaacagggcgaggtgatcgcggcgaaatacggcacgccggaggtcgctgcggtaaatctg
gacgcgatggtcaccgccgcgatgctcgccacgatggagcccgaacgggtgccgcaggac
gattatcgccgctatgccgaggcgatggatgcggtgtcggagaccgcgttcagcacctat
cgcgatctggtctacggcaccgatgggttcgtcggattcttccgtcagatgactcccatc
gcggagatcgccacgctcaagatcggatcgcgcccggcgagccgcaagtcggacgaccgg
atcgagaatctgcgcgcgattccttgggtcttctcgtggagccaggcgcgggtgatgctg
cccggctggtacggggtcggcacggcgctgtcgcagttcgaagacaaggcgctgctgcgc
gaaatggcgcgcgaatggccgttcctgcgcaacgcgctcgccaatatggaaatggtgctc
gccaaatccgacatgggcattgccgagcgttacagcgaactggtcgaggatcgcgatctg
gcgaagggcgtgttcggggcgatccgcgacgaatggcagcgcacgcatgacgcgctgctg
gatgcgaccgggcagtccttcctgctcgaaaattcgccccgcctcgatgcgtcgatccgg
ctgcggctgccctatatcgaaccgctcaacctcttgcaggtcgaattgctcaagcggcac
cgtagcggcgagccggacgagcggattgccgaaggcatccagctgtcgatcaacgccatc
gcgaccgcgctgcgcaacagcggttga

DBGET integrated database retrieval system