KEGG   Citromicrobium sp. JL477: WG74_06050Help
Entry
WG74_06050        CDS       T04089                                 

Definition
(GenBank) aldehyde dehydrogenase
Organism
cij  Citromicrobium sp. JL477
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: ALG60452
LinkDB All DBs
Position
complement(1250420..1251907)
Genome map
AA seq 495 aa AA seqDB search
MDYAQHPLARPDKLFIDGEWVSPQQKGAITVISPATERPYVEVAQAGMEDIDRAIGAARR
AFDEGPWPRLPVAERAHFLHAIATEVEASTDDIAAIWPNEMGITHAVASAFSGTIGGIYR
AYAHMAHSFDFLEPRLSALAPAAYIAHEPVGVVGAIIPWNGPISLIAHKIAPALLAGCTV
IVKASPEAPGHALLMAEILEKVGLPAGVVNVLTADRDVSEQLVRDPRVDKIAFTGSTATG
QAIGSILGGRIGRQTLELGGKSPAIICEDYDIDLAAETLAERACALTGQVCASLTRLIVP
RRRHDDFLEALASRMAKISVGDPFDPATGMGPLATAQQRSRVEGHIARAVADGYAPATGG
ARPAHLDRGWFVEPTVFGNVDNSSAIAREEIFGPVLCVIPAQDEDEAVHIANDSPFGLAG
AVFTNDAERAYRIMRQVRTGTMSQNRLKLDFSIGFGGFKQSGIGREGGEQGLRSFLETKT
MLLDAPVNTAGQDAE
NT seq 1488 nt NT seq  +upstreamnt  +downstreamnt
atggattacgcacagcatcccctcgcccggcccgataagctgttcattgatggcgagtgg
gtttcgccgcagcagaagggcgcgatcactgtcatctctccggcgaccgagcggccttat
gtcgaggtggcgcaagcgggcatggaggatattgaccgcgccatcggtgcggcacgccgt
gcgttcgacgaaggtccgtggccgcgcctgccggtggcggagcgtgcgcatttcctccac
gcgatcgcgaccgaggtggaggcgagcaccgatgatatcgccgccatctggcccaatgaa
atgggcattacccacgccgtagccagcgccttctccgggaccatcggcggcatttatcgc
gcctacgcgcacatggcgcacagtttcgatttcctcgaaccgcgcctgagcgcactcgcc
ccagcagcctatattgcgcacgaacccgtcggtgtcgtcggcgccatcattccctggaac
gggccgatttcgctgatcgctcacaagatcgcgccggccttgcttgcgggatgcacggtg
atcgtgaaggcatcgcccgaagcgcccggccacgctttgctgatggccgagatactggaa
aaggtgggcctgcccgcgggcgtggtcaatgtgctgaccgccgatcgcgacgtgtcggaa
cagctcgtgcgcgatccgcgggtcgacaagatcgccttcaccggctccactgcgacggga
caggcgatcggttcgatcctggggggacgcatcgggcgccagacgctggaactgggcggc
aagtccccggcgataatctgcgaagattacgacattgatcttgcggcggagaccttggct
gagcgcgcttgcgcccttaccgggcaagtctgcgcatcgctgacccgacttatcgttccg
cgccgccgccacgacgactttcttgaagcgctcgccagccggatggcgaagatcagcgtg
ggcgatcccttcgacccagcgaccggcatggggccgctcgccaccgcgcagcaacgctcc
cgggtcgaggggcacatcgcccgtgccgttgcggacggatatgctcccgctaccggcggg
gcgcgccctgcccatctcgatcggggctggttcgtggagccgaccgtgttcggtaatgtc
gacaattcgtcggccattgcgcgtgaggagattttcggtccggtgctctgcgtgatacca
gcgcaagacgaggatgaggcagtgcacatcgccaacgacagccccttcggcctagccgga
gcggtgttcacgaacgatgccgaacgcgcctatcgcattatgcgccaggtgcgcacgggc
acgatgagccagaacaggctcaagctcgatttctcgatcgggttcggcggcttcaagcaa
tcgggcatcggccgcgaaggtggggaacagggtttgcgcagtttcctggaaacgaagacg
atgctgctcgatgcgcctgtaaatacagccggtcaggacgccgaatag

DBGET integrated database retrieval system