KEGG   Citromicrobium sp. JL477: WG74_07640Help
Entry
WG74_07640        CDS       T04089                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
cij  Citromicrobium sp. JL477
Pathway
cij00473  D-Alanine metabolism
cij00550  Peptidoglycan biosynthesis
cij01100  Metabolic pathways
cij01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:cij00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    WG74_07640
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    WG74_07640
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    WG74_07640
Enzymes [BR:cij01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     WG74_07640
Peptidoglycan biosynthesis and degradation proteins [BR:cij01011]
 Precursor biosynthesis
  Amino acid ligase
   WG74_07640
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp_3 ATP-grasp_4
Motif
Other DBs
NCBI-ProteinID: ALG60715
LinkDB All DBs
Position
1601551..1602516
Genome map
AA seq 321 aa AA seqDB search
MILSNKLHVAVLMGGWANERPVSLMSGEGVAKALEARGHTVTRIDMDRQVAARIAEAKPD
IVFNALHGVPGEDGTVQGMLDLMGVPYTHSGLATSVIAIDKQLTKQALVPRGIPMPGGRI
VKTDDLYEGDPLPRPYVLKPVNEGSSVGVAIVTDESNYGNPIARDAKGPWQEFPELLAEP
YIRGRELTTAVVGGKALGVTELIVESGFYDFENKYTDGRTRHVCPAEIPEDVAEACLRYA
LEAHRILGCKGTSRTDFRWDDQQGLDGLFVLETNTQPGMTPLSLVPEQAKYCGMSYEDLV
ETIIADALADRGGHDGAQGQA
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atgatcctctccaacaaactccacgtcgcggtcctgatgggcggctgggccaatgagcgg
cccgtctcgttaatgagcggggagggcgtggccaaggcgctcgaagcgcgcgggcacacc
gtcacacggatcgatatggaccggcaggtcgccgcgcggattgccgaggcgaaaccggac
atcgtgttcaacgcgctccacggcgtgccgggcgaggatggcacggtgcagggcatgctc
gacctgatgggcgtgccctatacccacagcggcctcgccacctcggtgatcgcgatcgac
aagcagctgaccaagcaggcgctggttccgcgcggcattcccatgcccggcgggcggatc
gtcaagaccgacgacctgtacgaaggcgacccgctgccgcggccctatgtgctcaagccg
gtcaacgaaggctcctcggtcggggtggcgatcgtcaccgacgagagcaattacggcaac
ccgatcgcgcgcgatgcgaagggcccgtggcaggaattccccgaactgctcgccgaaccc
tatattcgcggacgcgagctgactacggcggtggtcggcggcaaggcgctgggcgttacc
gagctgatcgtcgagagcggcttctacgatttcgagaacaagtacaccgacgggcgcacg
cgccacgtctgccccgccgaaatccccgaggatgttgccgaggcctgcctgcgctacgcg
ctcgaggcgcaccgcatcctcggctgcaagggcaccagccgcaccgatttccgctgggac
gaccagcaggggctggacgggctgttcgtgcttgaaaccaacacccagccgggcatgacc
ccgctcagcctggtgcccgagcaggcaaaatactgcggaatgagctacgaggatctggtc
gagacgattatcgccgatgcgctcgcagacaggggaggacatgatggcgcgcaaggtcaa
gcgtaa

DBGET integrated database retrieval system