Citromicrobium sp. JL477: WG74_15725 Help Entry WG74_15725        CDS       T04089                                  Name (GenBank) hypothetical protein   KO K02398   negative regulator of flagellin synthesis FlgM Organism cij  Citromicrobium sp. JL477 Pathway cij02020   Two-component system cij02040   Flagellar assembly Brite KEGG Orthology (KO) [BR:cij00001]  09130 Environmental Information Processing   09132 Signal transduction    02020 Two-component system     WG74_15725  09140 Cellular Processes   09142 Cell motility    02040 Flagellar assembly     WG74_15725  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02035 Bacterial motility proteins [BR:cij02035]     WG74_15725 Bacterial motility proteins [BR:cij02035]  Flagellar system   Flagellar assembly proteins    Others     WG74_15725 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FlgM Motif Other DBs NCBI-ProteinID:  ALG62102 UniProt:  A0A8D3Z210 LinkDB All DBs Position complement(3239043..3239285) Genome browser AA seq 80 aa AA seqDB search MRRGVAPVERVSAPQKTADQAASTQGMSAVSMPDAGDSAPIDSDRVARIRGAIESGTYPL VPTEIAEGIIASGLFQNSGE NT seq 243 nt NT seq  +upstreamnt  +downstreamnt ttgcgccgcggcgtcgcgccggtcgagcgcgtgtccgctccgcaaaagacggccgatcag gcggccagcacgcaaggtatgagcgcggtttcgatgccggacgcgggcgacagcgccccg atcgacagcgatcgcgtggcacggattcgcggcgcgatcgaaagcggtacctatccgctg gtcccgaccgagattgccgagggcatcatcgcctccggcctgttccagaatagcggcgag taa

DBGET integrated database retrieval system