KEGG   Coccidioides immitis: CIMG_00337Help
Entry
CIMG_00337        CDS       T01114                                 

Definition
(RefSeq) phosphopantothenate-cysteine ligase
  KO
K01922  phosphopantothenate---cysteine ligase (ATP) [EC:6.3.2.51]
Organism
cim  Coccidioides immitis
Pathway
cim00770  Pantothenate and CoA biosynthesis
cim01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cim00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    CIMG_00337
Enzymes [BR:cim01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.51  phosphopantothenate---cysteine ligase (ATP)
     CIMG_00337
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DFP FleQ
Motif
Other DBs
NCBI-GeneID: 4565449
NCBI-ProteinID: XP_001246566
UniProt: J3KGS7
LinkDB All DBs
AA seq 429 aa AA seqDB search
MAAKTVPMDSLSPDEMESHYFKTNPPPIHLQTHITIARAFINRHVEAGRRVVLVTSGGTT
VPLEAQTVRFIDNFSAGTRGATSAEYFLQEGYAVIFLHRQFSLLPYSRHYSHSTNCFLDF
MDEAPSQSASSSLSSTIGEKNTEHGPIVVRTEYQDDMRKVLRQYRYAKENNLLLLLPFTT
VTEYLYELRALATLMQPLGVNALFYLAAAVSDFFIPRDRMAEHKIQSSNEVPIPGQAPTK
PDTAAHTVPESTSAILPDHIYTGFNDPNGPPKHQKKLVVDLDPVPKFLHRLVNGWAPAGS
MIVSFKLETDPALLVLKSEQALQRYSHHLVIGNLLSNRKWEVVFVSRKPDGAIQERWIRI
PRPRRSVSGALPGMSAGLQAGLSPAAAAAAAAAAHEHAQKEVEIESVIIPELKKMHTVMI
ERAKTKETK
NT seq 1290 nt NT seq  +upstreamnt  +downstreamnt
atggccgccaaaaccgttcctatggactccttgagccccgatgagatggaatctcactat
ttcaagacgaatcccccgcccatccacctccagacccatattacaatcgcgcgagcgttc
ataaataggcatgtggaggccggtcggcgagtggtgctggtgacatctggcggcaccacg
gtgcctcttgaggcacagacggtcaggttcatcgacaatttctctgccggaactcgtggc
gctacatcggccgaatacttcttgcaggagggctacgctgtgatcttcttacatcgacag
ttcagtctgcttccttattcgcgccattacagtcactcaaccaactgctttcttgatttc
atggacgaagccccctcgcagtcggcatcctcgtcgctctcttcaacaattggcgaaaag
aacaccgaacatggacctatcgtggtgcggactgagtatcaggatgatatgcgtaaggtc
ctgcgacagtatcgatacgccaaagaaaacaatcttcttctcttattgccattcacaacc
gtaaccgaatacctctacgagctccgcgccctagcaaccctcatgcaacccctcggtgtc
aacgcgctcttctacctcgcggccgccgtatccgatttcttcattccccgcgaccgaatg
gccgaacacaaaatccaatcttccaacgaagtccccattcccggccaggcaccaaccaaa
cccgacacagccgcccacaccgtccccgaaagcacctccgccatcctcccagatcacatc
tacaccggcttcaacgaccccaacggacccccaaaacatcagaagaaactcgtcgttgac
cttgaccccgtacccaagttcctccaccgcctcgtgaacggctgggccccggccggctcc
atgatcgtcagcttcaagctcgagaccgacccggcccttctcgttctgaaatcagaacag
gcactccagcgctactcacaccacctcgtcatcggcaacctcctctccaatcggaaatgg
gaagtcgtcttcgtgagcaggaagcccgacggcgccattcaggagcgctggatccggatc
cctaggccgagaagaagtgtgagtggtgcgttgccgggaatgagcgctggacttcaggct
ggtttgtcacctgctgccgcggcagcggccgcggccgccgcgcacgagcacgctcagaag
gaggttgagatcgagagcgtaatcatcccggagttaaagaagatgcatacagttatgatc
gaaagagcaaaaaccaaggagacgaaatga

DBGET integrated database retrieval system