KEGG   Coccidioides immitis: CIMG_00997Help
Entry
CIMG_00997        CDS       T01114                                 

Definition
(RefSeq) hexokinase
  KO
K00844  hexokinase [EC:2.7.1.1]
Organism
cim  Coccidioides immitis
Pathway
cim00010  Glycolysis / Gluconeogenesis
cim00051  Fructose and mannose metabolism
cim00052  Galactose metabolism
cim00500  Starch and sucrose metabolism
cim00520  Amino sugar and nucleotide sugar metabolism
cim01100  Metabolic pathways
cim01110  Biosynthesis of secondary metabolites
cim01130  Biosynthesis of antibiotics
cim01200  Carbon metabolism
Module
cim_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
cim_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:cim00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CIMG_00997
   00051 Fructose and mannose metabolism
    CIMG_00997
   00052 Galactose metabolism
    CIMG_00997
   00500 Starch and sucrose metabolism
    CIMG_00997
   00520 Amino sugar and nucleotide sugar metabolism
    CIMG_00997
Enzymes [BR:cim01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     CIMG_00997
Membrane trafficking [BR:cim04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    CIMG_00997
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hexokinase_2 Hexokinase_1 DUF2587
Motif
Other DBs
NCBI-GeneID: 4565527
NCBI-ProteinID: XP_001247226
UniProt: J3KI71
LinkDB All DBs
AA seq 490 aa AA seqDB search
MTVTAPRRRPSRKGSMADMPKDLLEQVKELEELFTVDQARLKKIVDHFVKELEKGLSVQG
GNIPMNVTWVMGFPTGHEHGTFLALDMGGTNLRVCEIFLCEKKGEFDITQSKYRIPEELK
SGNADDLWEYIADCVQQFIEYHHEEENLPDLPLGFTFSYPATQEYIDHGVLQRWTKGFDI
DGVEGEDVVPMLEAALAKRGLPIKVAALINDTTGTLIASAYTDPEMRIGCIFGTGVNAAY
MENAGSIPKIAHYNLPPDMPIAINCEYGAFDNERVVLPLTQYDVVIDRDSPRPGQQAFEK
MTAGLYLGEIFRLVLLDLIDNKGNLIFEGQDVSSLRKPYCLDSSFLAYIEEDPFENLSET
RDLFERTLGIKATKPELELCRRLAELVGTRAARLSACGVAAICKKKNIKSCHVGADGSVF
NKYPHFKARGAKALREILDWADDEEDKVIICSAEDGSGVGAALIAALTLERVKQGNLAGI
RKTDTMKKLL
NT seq 1473 nt NT seq  +upstreamnt  +downstreamnt
atgacggtcaccgctcctcgccgaaggccgtcccggaagggatcaatggccgatatgcca
aaggacctgctcgagcaggtgaaggagctcgaggagctcttcacagtcgaccaggctcgg
ttgaagaaaatcgtggaccactttgtaaaggagctggagaaaggtctcagtgtacagggt
ggaaacatccctatgaatgtcacttgggttatgggctttcccactggccatgaacacggt
acgttcctcgcgcttgatatgggcggtaccaacctccgtgtttgcgagatcttcctttgc
gagaagaagggtgaattcgacatcactcagtccaaatatcgcattcccgaggagttgaag
agcggcaatgccgatgacctctgggaatacatcgccgattgtgttcagcagttcattgaa
taccaccatgaggaggaaaatttaccggacctacccctgggcttcaccttctcctatccc
gctacgcaggagtatattgaccacggtgtgttacaacgatggaccaagggctttgatatt
gacggcgtggagggcgaggatgttgtgcctatgttagaagcggcccttgcaaagaggggt
ctcccgatcaaagtcgctgccttgatcaatgataccaccggaactctgatcgcctctgct
tacactgatcctgagatgaggattggctgcatcttcggaacaggagttaacgcggcatac
atggagaatgcgggatccatcccaaaaatcgctcattacaaccttccccctgatatgccc
atcgccattaactgtgaatatggtgcctttgataacgagcgtgtggtgcttccgttgact
caatatgacgtcgtgattgaccgtgactccccgcggcccgggcaacaggccttcgaaaag
atgaccgccggtctgtatcttggcgaaatcttccggctggtccttctagaccttattgac
aacaaaggcaatctcattttcgaaggccaggacgtcagcagcctccggaaaccgtactgc
ctagactcttccttcctggcgtacatcgaagaagatcctttcgagaacttgtctgaaacc
agggatcttttcgagcgcactcttggaatcaaggccaccaagcctgagcttgagctctgc
cgccgcctggcagaacttgttggtactcgcgccgcacgcctctccgcttgcggtgtcgcg
gccatttgcaaaaagaagaatatcaaatcttgccatgttggagctgacggttccgtcttc
aacaaatatccccatttcaaggcccgtggagccaaggcacttcgtgagatcctcgactgg
gctgatgatgaggaagataaggtcattatatgctctgccgaggacggttctggtgttggt
gccgcactgatcgcagcgctgacgctcgagagagttaagcagggaaatctagccggtatt
cgaaagacagacacgatgaagaagctgctgtga

DBGET integrated database retrieval system