KEGG   Coccidioides immitis: CIMG_01553Help
Entry
CIMG_01553        CDS       T01114                                 

Definition
(RefSeq) glucoamylase
  KO
K01178  glucoamylase [EC:3.2.1.3]
Organism
cim  Coccidioides immitis
Pathway
cim00500  Starch and sucrose metabolism
cim01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cim00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    CIMG_01553
Enzymes [BR:cim01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     CIMG_01553
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_15 CBM_20
Motif
Other DBs
NCBI-GeneID: 4567387
NCBI-ProteinID: XP_001247782
UniProt: A0A0E1RYJ4
LinkDB All DBs
AA seq 619 aa AA seqDB search
MMLSILRALYAVPLVYSLVSGSEAKFALRQEETLEQWLETESSYALQSILDNIGDDGAKV
QGAHAGIVVASPSRADPDYFYTWTRDAALVFKHLIDAFVAGNHDSQDRIHEYITAQSYLQ
TVSNPSGTLSTGGLGEPKFHVDQSAFTGSWGRPQADGPALRATAMITYAKWLIANGHEDA
AKSIVWPVVQNDLSYVGQFWNSTGFDLWEEVQGSSFFTAIAQHRALAEGNNLARQLGTDC
PHCESQAPQILCFLQSFWTGSNIIANFGGDRSGLDANSLLGIIHNFDPEADCDDNTFQPC
SSRALANHKKVTDSFREIYPINSGMEGDQAVAVGRYAEDVYYGGQPWYLATFASAELLYD
AIYQWNHTGKITITDVSLPFFQSIYKSAQVGTYSSSTNVFSEIIANVGSYADGYLNVARK
YTPCSGALAEQFSRNDGTPLSASDLTWSYAALLTAKERRESVVPGSWGQKSAHDVPPTCL
ATSAAGSYQTATITGWPSTLTPTPTPTNPAPCPTPSSVKITFQSVTDTKWGENIFLVGSI
PELGSWEPSAAKQLKADKYEASCPLWSIQIDLAAGKKFDYRYIRKSDDGRVVWESDPNRS
YTVPKKCGVSSLVLKSTWR
NT seq 1860 nt NT seq  +upstreamnt  +downstreamnt
atgatgctatccatcctcagagcgttatacgccgtccctctggtctatagcctggtcagc
ggttcggaggcaaagttcgcactgcggcaagaagagaccttggagcaatggcttgaaacg
gagagctcatatgccctccaatctattcttgacaatatcggggacgacggggcgaaagtg
cagggtgctcatgctggtattgtcgttgcgagcccgagcagggctgatccggattatttt
tatacatggactcgagacgccgccctcgtcttcaaacacctaatcgatgcttttgttgct
ggaaaccatgactcgcaggatcgcatccacgaatatatcaccgctcaatcatatttacag
accgtgtcgaatccgtctggaactttgtcgactggtggacttggtgagccaaagtttcat
gtggatcaatctgcgttcacagggagctgggggcggcctcaggcagacgggccggctctg
agagctactgcgatgattacctacgcgaaatggcttatcgccaatgggcatgaagatgcc
gcgaaatccatcgtatggcctgtcgtgcagaatgatctgtcgtacgttggccagttctgg
aactctactggatttgacctatgggaagaagttcagggatcgtcgttcttcacggcaatc
gcacaacatcgtgcgctcgcagaaggcaacaatcttgcccgccagcttgggacggattgt
cctcactgcgagtcgcaagcaccacaaatactttgcttcttgcagtcattctggaccggg
tccaacatcatcgcgaatttcgggggagacagatccggtcttgacgcaaactcccttctt
ggcatcatccataacttcgatccagaggcggattgcgatgataatacattccagccgtgc
tcgtcgagagcacttgcgaatcacaagaaggttacggattcttttcgtgaaatatacccg
ataaattctggcatggaaggtgatcaggctgttgccgttggtcgatatgctgaagatgtt
tactatggaggacagccgtggtacctcgcgacgtttgcctctgccgagctcttgtatgat
gctatttaccaatggaatcatacgggcaagattaccatcaccgatgtgtcattgccattt
ttccaaagcatttacaagtcagctcaggttggaacttattcctcctcaactaatgtcttc
tctgagatcattgccaatgtcgggagctatgccgacgggtacttgaatgttgcaagaaaa
tacacgccttgctctggggcactagctgagcagttctcaagaaacgatgggacaccacta
tctgcgagtgacctgacttggtcgtacgctgctcttttgacagcaaaagagagacgggaa
tcggttgtgccgggatcatggggtcaaaaatctgcgcacgacgttccaccgacctgcttg
gcaacatcggcggctggaagttatcaaaccgcgaccataacagggtggccttcaactctg
actccaactccaactccaaccaacccggcaccatgcccaaccccaagcagtgtcaaaatc
actttccagtcggtcaccgacacaaaatggggcgaaaacatttttctcgttgggtctatt
ccagaattaggatcatgggagcccagtgcggcaaaacaactgaaagcggacaagtacgaa
gcctcttgccccctgtggtccattcagattgatctcgccgcggggaagaaattcgattac
agatatatccggaagagtgacgacggaagggtagtgtgggagagtgatccgaatcgatca
tataccgtcccgaagaagtgcggagtttcgtctctggttctgaagagcacttggcgctga

DBGET integrated database retrieval system